Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2458547..2458731 | Replicon | chromosome |
Accession | NZ_CP020020 | ||
Organism | Staphylococcus aureus strain ATCC 6538 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | B4602_RS12830 | Protein ID | WP_000482647.1 |
Coordinates | 2458624..2458731 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2458547..2458607 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B4602_RS12805 | 2454001..2454168 | - | 168 | WP_001790576.1 | hypothetical protein | - |
B4602_RS12815 | 2454399..2456132 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
B4602_RS12820 | 2456157..2457920 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein/permease | - |
- | 2458547..2458607 | + | 61 | - | - | Antitoxin |
B4602_RS12830 | 2458624..2458731 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
B4602_RS12835 | 2458865..2459251 | - | 387 | WP_000779360.1 | flippase GtxA | - |
B4602_RS12840 | 2459509..2460651 | + | 1143 | WP_042727740.1 | glycerate kinase | - |
B4602_RS12845 | 2460711..2461370 | + | 660 | WP_000831298.1 | membrane protein | - |
B4602_RS12850 | 2461552..2462763 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
B4602_RS12855 | 2462886..2463359 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T73785 WP_000482647.1 NZ_CP020020:c2458731-2458624 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T73785 NZ_CP020020:c2458731-2458624 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT73785 NZ_CP020020:2458547-2458607 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACTAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACTAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|