Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2493172..2493356 | Replicon | chromosome |
Accession | NZ_CP020019 | ||
Organism | Staphylococcus aureus strain 08S00974 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | B4603_RS12905 | Protein ID | WP_000482647.1 |
Coordinates | 2493249..2493356 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2493172..2493232 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B4603_RS12880 | 2488626..2488793 | - | 168 | WP_001798790.1 | hypothetical protein | - |
B4603_RS12890 | 2489024..2490757 | - | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein/permease | - |
B4603_RS12895 | 2490782..2492545 | - | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein/permease | - |
- | 2493172..2493232 | + | 61 | - | - | Antitoxin |
B4603_RS12905 | 2493249..2493356 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
B4603_RS12910 | 2493490..2493876 | - | 387 | WP_000779355.1 | flippase GtxA | - |
B4603_RS12915 | 2494143..2495285 | + | 1143 | WP_001176859.1 | glycerate kinase | - |
B4603_RS12920 | 2495345..2496004 | + | 660 | WP_000831300.1 | hypothetical protein | - |
B4603_RS12925 | 2496192..2497403 | + | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
B4603_RS12930 | 2497526..2497999 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T73774 WP_000482647.1 NZ_CP020019:c2493356-2493249 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T73774 NZ_CP020019:c2493356-2493249 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT73774 NZ_CP020019:2493172-2493232 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|