Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
| Location | 2197248..2197446 | Replicon | chromosome |
| Accession | NZ_CP020019 | ||
| Organism | Staphylococcus aureus strain 08S00974 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | B4603_RS11275 | Protein ID | WP_001802298.1 |
| Coordinates | 2197342..2197446 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2197248..2197286 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B4603_RS11255 | 2193368..2194033 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
| B4603_RS11260 | 2194185..2194505 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| B4603_RS11265 | 2194507..2195487 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
| B4603_RS11270 | 2195753..2196844 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
| - | 2197248..2197286 | + | 39 | - | - | Antitoxin |
| B4603_RS11275 | 2197342..2197446 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| B4603_RS11285 | 2198126..2198284 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| B4603_RS11290 | 2198720..2198812 | + | 93 | WP_000220902.1 | hypothetical protein | - |
| B4603_RS11295 | 2198942..2199799 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
| B4603_RS11300 | 2199867..2200649 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
| B4603_RS11305 | 2200939..2201547 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T73773 WP_001802298.1 NZ_CP020019:c2197446-2197342 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T73773 NZ_CP020019:c2197446-2197342 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT73773 NZ_CP020019:2197248-2197286 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|