Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1946830..1947010 | Replicon | chromosome |
| Accession | NZ_CP019945 | ||
| Organism | Staphylococcus aureus strain BA01611 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | AOZ05_RS15315 | Protein ID | WP_001801861.1 |
| Coordinates | 1946830..1946925 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1946953..1947010 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AOZ05_RS09960 | 1942206..1942949 | + | 744 | WP_175393121.1 | exotoxin | - |
| AOZ05_RS09965 | 1942976..1943728 | + | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
| AOZ05_RS09970 | 1943789..1944961 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| AOZ05_RS09975 | 1945192..1945748 | - | 557 | Protein_1879 | ImmA/IrrE family metallo-endopeptidase | - |
| AOZ05_RS09980 | 1945932..1946378 | - | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
| AOZ05_RS15315 | 1946830..1946925 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1946953..1947010 | - | 58 | - | - | Antitoxin |
| AOZ05_RS09990 | 1947576..1949271 | - | 1696 | Protein_1882 | hypothetical protein | - |
| AOZ05_RS10000 | 1949531..1950703 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| AOZ05_RS10005 | 1950755..1951435 | - | 681 | Protein_1884 | DNA adenine methylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk | 1938995..1970958 | 31963 | |
| - | inside | IScluster/Tn | - | - | 1943789..1950703 | 6914 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T73543 WP_001801861.1 NZ_CP019945:1946830-1946925 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T73543 NZ_CP019945:1946830-1946925 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT73543 NZ_CP019945:c1947010-1946953 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|