Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 817275..817497 | Replicon | chromosome |
Accession | NZ_CP019903 | ||
Organism | Escherichia coli strain MDR_56 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | B1200_RS29965 | Protein ID | WP_001295224.1 |
Coordinates | 817275..817382 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 817431..817497 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B1200_RS04265 | 812809..812997 | - | 189 | WP_001063315.1 | YhjR family protein | - |
B1200_RS04270 | 813270..814841 | + | 1572 | WP_001204944.1 | cellulose biosynthesis protein BcsE | - |
B1200_RS04275 | 814838..815029 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
B1200_RS04280 | 815026..816705 | + | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
B1200_RS04285 | 816792..816899 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
B1200_RS29965 | 817275..817382 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 817431..817497 | + | 67 | - | - | Antitoxin |
B1200_RS04310 | 817858..819129 | + | 1272 | WP_001318103.1 | amino acid permease | - |
B1200_RS04315 | 819159..820163 | - | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
B1200_RS04320 | 820160..821143 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
B1200_RS04325 | 821154..822056 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T73441 WP_001295224.1 NZ_CP019903:c817382-817275 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T73441 NZ_CP019903:c817382-817275 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT73441 NZ_CP019903:817431-817497 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|