Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2014565..2014864 | Replicon | chromosome |
Accession | NZ_CP019594 | ||
Organism | Staphylococcus aureus strain GD1539 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | BZK08_RS10335 | Protein ID | WP_011447039.1 |
Coordinates | 2014688..2014864 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2014565..2014620 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BZK08_RS10290 | 2009896..2010156 | + | 261 | WP_001791826.1 | hypothetical protein | - |
BZK08_RS10295 | 2010209..2010559 | - | 351 | WP_084568216.1 | complement inhibitor SCIN-A | - |
BZK08_RS10300 | 2011244..2011693 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
BZK08_RS10305 | 2011788..2012123 | - | 336 | Protein_1907 | SH3 domain-containing protein | - |
BZK08_RS10315 | 2012773..2013264 | - | 492 | WP_000919350.1 | staphylokinase | - |
BZK08_RS10320 | 2013455..2014210 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
BZK08_RS10325 | 2014222..2014476 | - | 255 | WP_000611512.1 | phage holin | - |
BZK08_RS10330 | 2014528..2014635 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2014557..2014696 | + | 140 | NuclAT_0 | - | - |
- | 2014557..2014696 | + | 140 | NuclAT_0 | - | - |
- | 2014557..2014696 | + | 140 | NuclAT_0 | - | - |
- | 2014557..2014696 | + | 140 | NuclAT_0 | - | - |
- | 2014565..2014620 | + | 56 | - | - | Antitoxin |
BZK08_RS10335 | 2014688..2014864 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
BZK08_RS10340 | 2015014..2015310 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
BZK08_RS10345 | 2015368..2015655 | - | 288 | WP_084568217.1 | hypothetical protein | - |
BZK08_RS10350 | 2015702..2015854 | - | 153 | WP_001153681.1 | hypothetical protein | - |
BZK08_RS10355 | 2015844..2019629 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hlb / scn / chp / sak / hlb / groEL | 2008834..2063669 | 54835 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T72784 WP_011447039.1 NZ_CP019594:c2014864-2014688 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T72784 NZ_CP019594:c2014864-2014688 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTACAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTACAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT72784 NZ_CP019594:2014565-2014620 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|