Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2005984..2006283 | Replicon | chromosome |
Accession | NZ_CP019592 | ||
Organism | Staphylococcus aureus strain GD5 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | BZJ79_RS10160 | Protein ID | WP_011447039.1 |
Coordinates | 2006107..2006283 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2005984..2006039 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BZJ79_RS10105 | 2001315..2001575 | + | 261 | WP_001791826.1 | hypothetical protein | - |
BZJ79_RS10110 | 2001628..2001978 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
BZJ79_RS10115 | 2002663..2003112 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
BZJ79_RS14360 | 2003207..2003542 | - | 336 | Protein_1852 | SH3 domain-containing protein | - |
BZJ79_RS10140 | 2004192..2004683 | - | 492 | WP_000919350.1 | staphylokinase | - |
BZJ79_RS10145 | 2004874..2005629 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
BZJ79_RS10150 | 2005641..2005895 | - | 255 | WP_000611512.1 | phage holin | - |
BZJ79_RS10155 | 2005947..2006054 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2005976..2006115 | + | 140 | NuclAT_0 | - | - |
- | 2005976..2006115 | + | 140 | NuclAT_0 | - | - |
- | 2005976..2006115 | + | 140 | NuclAT_0 | - | - |
- | 2005976..2006115 | + | 140 | NuclAT_0 | - | - |
- | 2005984..2006039 | + | 56 | - | - | Antitoxin |
BZJ79_RS10160 | 2006107..2006283 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
BZJ79_RS10165 | 2006433..2006729 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
BZJ79_RS10170 | 2006787..2007074 | - | 288 | WP_084568217.1 | hypothetical protein | - |
BZJ79_RS10175 | 2007121..2007273 | - | 153 | WP_001153681.1 | hypothetical protein | - |
BZJ79_RS10180 | 2007263..2011048 | - | 3786 | WP_060555201.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2001628..2057039 | 55411 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T72754 WP_011447039.1 NZ_CP019592:c2006283-2006107 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T72754 NZ_CP019592:c2006283-2006107 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTACAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTACAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT72754 NZ_CP019592:2005984-2006039 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|