Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2117885..2118083 | Replicon | chromosome |
Accession | NZ_CP019591 | ||
Organism | Staphylococcus aureus strain 293G |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | BXP64_RS10785 | Protein ID | WP_001802298.1 |
Coordinates | 2117979..2118083 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2117885..2117923 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BXP64_RS10765 | 2114005..2114670 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
BXP64_RS10770 | 2114822..2115142 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
BXP64_RS10775 | 2115144..2116124 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
BXP64_RS10780 | 2116390..2117481 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 2117885..2117923 | + | 39 | - | - | Antitoxin |
BXP64_RS10785 | 2117979..2118083 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
BXP64_RS10800 | 2118763..2118921 | + | 159 | WP_001792784.1 | hypothetical protein | - |
BXP64_RS10805 | 2119357..2119449 | + | 93 | WP_000220902.1 | hypothetical protein | - |
BXP64_RS10810 | 2119579..2120436 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
BXP64_RS10815 | 2120504..2121286 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
BXP64_RS10820 | 2121576..2122184 | - | 609 | WP_000101715.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T72747 WP_001802298.1 NZ_CP019591:c2118083-2117979 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T72747 NZ_CP019591:c2118083-2117979 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT72747 NZ_CP019591:2117885-2117923 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|