Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2096767..2097066 | Replicon | chromosome |
Accession | NZ_CP019590 | ||
Organism | Staphylococcus aureus strain C2406 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | BJN19_RS10920 | Protein ID | WP_011447039.1 |
Coordinates | 2096890..2097066 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2096767..2096822 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BJN19_RS10865 | 2092098..2092358 | + | 261 | WP_001791826.1 | hypothetical protein | - |
BJN19_RS10870 | 2092411..2092761 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
BJN19_RS10875 | 2093446..2093895 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
BJN19_RS15225 | 2093990..2094325 | - | 336 | Protein_2005 | SH3 domain-containing protein | - |
BJN19_RS10900 | 2094975..2095466 | - | 492 | WP_000919350.1 | staphylokinase | - |
BJN19_RS10905 | 2095657..2096412 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
BJN19_RS10910 | 2096424..2096678 | - | 255 | WP_000611512.1 | phage holin | - |
BJN19_RS10915 | 2096730..2096837 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2096759..2096898 | + | 140 | NuclAT_0 | - | - |
- | 2096759..2096898 | + | 140 | NuclAT_0 | - | - |
- | 2096759..2096898 | + | 140 | NuclAT_0 | - | - |
- | 2096759..2096898 | + | 140 | NuclAT_0 | - | - |
- | 2096767..2096822 | + | 56 | - | - | Antitoxin |
BJN19_RS10920 | 2096890..2097066 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
BJN19_RS10925 | 2097216..2097512 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
BJN19_RS10930 | 2097570..2097857 | - | 288 | WP_001040261.1 | hypothetical protein | - |
BJN19_RS10935 | 2097904..2098056 | - | 153 | WP_001153681.1 | hypothetical protein | - |
BJN19_RS10940 | 2098046..2101831 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb | 2092411..2137411 | 45000 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T72726 WP_011447039.1 NZ_CP019590:c2097066-2096890 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T72726 NZ_CP019590:c2097066-2096890 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT72726 NZ_CP019590:2096767-2096822 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|