Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1935778..1935960 | Replicon | chromosome |
Accession | NZ_CP019590 | ||
Organism | Staphylococcus aureus strain C2406 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | BJN19_RS15200 | Protein ID | WP_001801861.1 |
Coordinates | 1935778..1935873 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1935901..1935960 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BJN19_RS09830 | 1931438..1932064 | + | 627 | Protein_1843 | hypothetical protein | - |
BJN19_RS09835 | 1932105..1932449 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
BJN19_RS09840 | 1932547..1933098 | + | 552 | WP_000414205.1 | hypothetical protein | - |
BJN19_RS09845 | 1933316..1933957 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
BJN19_RS09850 | 1934071..1934256 | - | 186 | WP_000809857.1 | hypothetical protein | - |
BJN19_RS09855 | 1934258..1934434 | - | 177 | WP_000375476.1 | hypothetical protein | - |
BJN19_RS09860 | 1934445..1934828 | - | 384 | WP_000070811.1 | hypothetical protein | - |
BJN19_RS09870 | 1935432..1935575 | - | 144 | WP_001549059.1 | transposase | - |
BJN19_RS15200 | 1935778..1935873 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1935901..1935960 | - | 60 | - | - | Antitoxin |
BJN19_RS09875 | 1935996..1936097 | + | 102 | WP_001791893.1 | hypothetical protein | - |
BJN19_RS09880 | 1936075..1936251 | - | 177 | Protein_1853 | transposase | - |
BJN19_RS09885 | 1936445..1936822 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1905413..2010519 | 105106 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T72723 WP_001801861.1 NZ_CP019590:1935778-1935873 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T72723 NZ_CP019590:1935778-1935873 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT72723 NZ_CP019590:c1935960-1935901 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|