Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1888122..1888304 | Replicon | chromosome |
| Accession | NZ_CP019574 | ||
| Organism | Staphylococcus aureus strain USA400-0051 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SAU400_RS14775 | Protein ID | WP_001801861.1 |
| Coordinates | 1888122..1888217 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1888245..1888304 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAU400_RS09490 | 1883793..1884419 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| SAU400_RS09495 | 1884460..1884801 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
| SAU400_RS09500 | 1884902..1885474 | + | 573 | WP_000414202.1 | hypothetical protein | - |
| SAU400_RS09505 | 1885672..1886229 | - | 558 | Protein_1782 | ImmA/IrrE family metallo-endopeptidase | - |
| SAU400_RS09515 | 1886602..1886778 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| SAU400_RS09520 | 1886789..1887172 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| SAU400_RS09530 | 1887776..1887919 | - | 144 | WP_001549059.1 | transposase | - |
| SAU400_RS14775 | 1888122..1888217 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1888245..1888304 | - | 60 | - | - | Antitoxin |
| SAU400_RS09540 | 1888340..1888441 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| SAU400_RS09545 | 1888419..1888595 | - | 177 | Protein_1788 | transposase | - |
| SAU400_RS09550 | 1888789..1889166 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1882029..1938999 | 56970 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T72688 WP_001801861.1 NZ_CP019574:1888122-1888217 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T72688 NZ_CP019574:1888122-1888217 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT72688 NZ_CP019574:c1888304-1888245 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|