Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 1604178..1604326 | Replicon | chromosome |
Accession | NZ_CP019573 | ||
Organism | Abyssicoccus albus strain S31 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | BVH56_RS09080 | Protein ID | WP_011276848.1 |
Coordinates | 1604178..1604273 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1604291..1604326 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BVH56_RS08190 | 1599198..1599845 | - | 648 | WP_000143686.1 | type A-8 chloramphenicol O-acetyltransferase | - |
BVH56_RS08195 | 1599981..1600565 | - | 585 | Protein_1589 | replication initiation factor domain-containing protein | - |
BVH56_RS08200 | 1600626..1601300 | - | 675 | WP_053037837.1 | IS6 family transposase | - |
BVH56_RS08205 | 1601330..1601668 | - | 339 | WP_077140972.1 | helix-turn-helix domain-containing protein | - |
BVH56_RS08210 | 1603396..1603641 | - | 246 | WP_142351102.1 | hypothetical protein | - |
BVH56_RS09080 | 1604178..1604273 | + | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1604291..1604326 | + | 36 | NuclAT_0 | - | Antitoxin |
BVH56_RS08215 | 1604553..1605122 | - | 570 | WP_077140973.1 | TetR/AcrR family transcriptional regulator | - |
BVH56_RS08220 | 1605471..1606415 | - | 945 | WP_002454675.1 | ABC transporter substrate-binding protein | - |
BVH56_RS08225 | 1606439..1609078 | - | 2640 | WP_002476238.1 | MMPL family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T72679 WP_011276848.1 NZ_CP019573:1604178-1604273 [Abyssicoccus albus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T72679 NZ_CP019573:1604178-1604273 [Abyssicoccus albus]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT72679 NZ_CP019573:1604291-1604326 [Abyssicoccus albus]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|