Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2399482..2399666 | Replicon | chromosome |
Accession | NZ_CP019563 | ||
Organism | Staphylococcus aureus strain SR434 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | BZP34_RS12440 | Protein ID | WP_000482647.1 |
Coordinates | 2399482..2399589 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2399606..2399666 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BZP34_RS12415 | 2394854..2395327 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
BZP34_RS12420 | 2395450..2396661 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
BZP34_RS12425 | 2396843..2397502 | - | 660 | WP_000831298.1 | membrane protein | - |
BZP34_RS12430 | 2397562..2398704 | - | 1143 | WP_072519225.1 | glycerate kinase | - |
BZP34_RS12435 | 2398962..2399348 | + | 387 | WP_000779347.1 | flippase GtxA | - |
BZP34_RS12440 | 2399482..2399589 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2399606..2399666 | - | 61 | - | - | Antitoxin |
BZP34_RS12455 | 2400217..2401980 | + | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
BZP34_RS12460 | 2402005..2403738 | + | 1734 | WP_077156124.1 | ABC transporter ATP-binding protein/permease | - |
BZP34_RS12470 | 2403969..2404136 | + | 168 | WP_001792506.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T72670 WP_000482647.1 NZ_CP019563:2399482-2399589 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T72670 NZ_CP019563:2399482-2399589 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT72670 NZ_CP019563:c2399666-2399606 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|