Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 75696..75965 | Replicon | plasmid pMRGN1031 |
Accession | NZ_CP019561 | ||
Organism | Escherichia coli strain KSC1031 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | BZY78_RS24595 | Protein ID | WP_001312861.1 |
Coordinates | 75807..75965 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 75696..75761 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BZY78_RS25745 | 71231..71437 | + | 207 | WP_000275853.1 | hypothetical protein | - |
BZY78_RS24570 | 71463..72002 | + | 540 | WP_000290838.1 | single-stranded DNA-binding protein | - |
BZY78_RS24575 | 72065..72298 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
BZY78_RS24580 | 72364..74322 | + | 1959 | WP_047402320.1 | ParB/RepB/Spo0J family partition protein | - |
BZY78_RS24585 | 74377..74811 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
BZY78_RS24590 | 74808..75527 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
BZY78_RS25605 | 75539..75727 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 75539..75763 | + | 225 | NuclAT_0 | - | - |
- | 75539..75763 | + | 225 | NuclAT_0 | - | - |
- | 75539..75763 | + | 225 | NuclAT_0 | - | - |
- | 75539..75763 | + | 225 | NuclAT_0 | - | - |
- | 75696..75761 | + | 66 | - | - | Antitoxin |
BZY78_RS24595 | 75807..75965 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BZY78_RS24615 | 77010..78014 | - | 1005 | WP_024257664.1 | IS110 family transposase | - |
BZY78_RS24620 | 78265..78552 | + | 288 | WP_000107548.1 | hypothetical protein | - |
BZY78_RS24625 | 78671..79492 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
BZY78_RS24630 | 79789..80391 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) | vat | 1..148529 | 148529 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T72657 WP_001312861.1 NZ_CP019561:75807-75965 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T72657 NZ_CP019561:75807-75965 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT72657 NZ_CP019561:75696-75761 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|