Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 547163..547385 Replicon chromosome
Accession NZ_CP019560
Organism Escherichia coli strain KSC1031

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag BZY78_RS02805 Protein ID WP_000170965.1
Coordinates 547163..547270 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 547318..547385 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BZY78_RS02765 543018..543851 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
BZY78_RS02770 543848..544240 + 393 WP_000200392.1 invasion regulator SirB2 -
BZY78_RS02775 544244..545053 + 810 WP_001257044.1 invasion regulator SirB1 -
BZY78_RS02780 545089..545943 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
BZY78_RS02785 546092..546199 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 546247..546313 + 67 NuclAT_26 - -
- 546247..546313 + 67 NuclAT_26 - -
- 546247..546313 + 67 NuclAT_26 - -
- 546247..546313 + 67 NuclAT_26 - -
- 546247..546313 + 67 NuclAT_28 - -
- 546247..546313 + 67 NuclAT_28 - -
- 546247..546313 + 67 NuclAT_28 - -
- 546247..546313 + 67 NuclAT_28 - -
- 546247..546313 + 67 NuclAT_30 - -
- 546247..546313 + 67 NuclAT_30 - -
- 546247..546313 + 67 NuclAT_30 - -
- 546247..546313 + 67 NuclAT_30 - -
- 546247..546313 + 67 NuclAT_32 - -
- 546247..546313 + 67 NuclAT_32 - -
- 546247..546313 + 67 NuclAT_32 - -
- 546247..546313 + 67 NuclAT_32 - -
- 546247..546313 + 67 NuclAT_34 - -
- 546247..546313 + 67 NuclAT_34 - -
- 546247..546313 + 67 NuclAT_34 - -
- 546247..546313 + 67 NuclAT_34 - -
- 546247..546313 + 67 NuclAT_36 - -
- 546247..546313 + 67 NuclAT_36 - -
- 546247..546313 + 67 NuclAT_36 - -
- 546247..546313 + 67 NuclAT_36 - -
- 546254..546312 + 59 NuclAT_38 - -
- 546254..546312 + 59 NuclAT_38 - -
- 546254..546312 + 59 NuclAT_38 - -
- 546254..546312 + 59 NuclAT_38 - -
- 546254..546312 + 59 NuclAT_40 - -
- 546254..546312 + 59 NuclAT_40 - -
- 546254..546312 + 59 NuclAT_40 - -
- 546254..546312 + 59 NuclAT_40 - -
- 546254..546312 + 59 NuclAT_42 - -
- 546254..546312 + 59 NuclAT_42 - -
- 546254..546312 + 59 NuclAT_42 - -
- 546254..546312 + 59 NuclAT_42 - -
BZY78_RS02795 546627..546734 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 546787..546848 + 62 NuclAT_37 - -
- 546787..546848 + 62 NuclAT_37 - -
- 546787..546848 + 62 NuclAT_37 - -
- 546787..546848 + 62 NuclAT_37 - -
- 546787..546848 + 62 NuclAT_39 - -
- 546787..546848 + 62 NuclAT_39 - -
- 546787..546848 + 62 NuclAT_39 - -
- 546787..546848 + 62 NuclAT_39 - -
- 546787..546848 + 62 NuclAT_41 - -
- 546787..546848 + 62 NuclAT_41 - -
- 546787..546848 + 62 NuclAT_41 - -
- 546787..546848 + 62 NuclAT_41 - -
- 546787..546849 + 63 NuclAT_25 - -
- 546787..546849 + 63 NuclAT_25 - -
- 546787..546849 + 63 NuclAT_25 - -
- 546787..546849 + 63 NuclAT_25 - -
- 546787..546849 + 63 NuclAT_27 - -
- 546787..546849 + 63 NuclAT_27 - -
- 546787..546849 + 63 NuclAT_27 - -
- 546787..546849 + 63 NuclAT_27 - -
- 546787..546849 + 63 NuclAT_29 - -
- 546787..546849 + 63 NuclAT_29 - -
- 546787..546849 + 63 NuclAT_29 - -
- 546787..546849 + 63 NuclAT_29 - -
- 546787..546849 + 63 NuclAT_31 - -
- 546787..546849 + 63 NuclAT_31 - -
- 546787..546849 + 63 NuclAT_31 - -
- 546787..546849 + 63 NuclAT_31 - -
- 546787..546849 + 63 NuclAT_33 - -
- 546787..546849 + 63 NuclAT_33 - -
- 546787..546849 + 63 NuclAT_33 - -
- 546787..546849 + 63 NuclAT_33 - -
- 546787..546849 + 63 NuclAT_35 - -
- 546787..546849 + 63 NuclAT_35 - -
- 546787..546849 + 63 NuclAT_35 - -
- 546787..546849 + 63 NuclAT_35 - -
- 546787..546850 + 64 NuclAT_14 - -
- 546787..546850 + 64 NuclAT_14 - -
- 546787..546850 + 64 NuclAT_14 - -
- 546787..546850 + 64 NuclAT_14 - -
- 546787..546850 + 64 NuclAT_16 - -
- 546787..546850 + 64 NuclAT_16 - -
- 546787..546850 + 64 NuclAT_16 - -
- 546787..546850 + 64 NuclAT_16 - -
- 546787..546850 + 64 NuclAT_18 - -
- 546787..546850 + 64 NuclAT_18 - -
- 546787..546850 + 64 NuclAT_18 - -
- 546787..546850 + 64 NuclAT_18 - -
- 546787..546850 + 64 NuclAT_20 - -
- 546787..546850 + 64 NuclAT_20 - -
- 546787..546850 + 64 NuclAT_20 - -
- 546787..546850 + 64 NuclAT_20 - -
- 546787..546850 + 64 NuclAT_22 - -
- 546787..546850 + 64 NuclAT_22 - -
- 546787..546850 + 64 NuclAT_22 - -
- 546787..546850 + 64 NuclAT_22 - -
- 546787..546850 + 64 NuclAT_24 - -
- 546787..546850 + 64 NuclAT_24 - -
- 546787..546850 + 64 NuclAT_24 - -
- 546787..546850 + 64 NuclAT_24 - -
BZY78_RS02805 547163..547270 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 547318..547385 + 68 NuclAT_13 - Antitoxin
- 547318..547385 + 68 NuclAT_13 - Antitoxin
- 547318..547385 + 68 NuclAT_13 - Antitoxin
- 547318..547385 + 68 NuclAT_13 - Antitoxin
- 547318..547385 + 68 NuclAT_15 - Antitoxin
- 547318..547385 + 68 NuclAT_15 - Antitoxin
- 547318..547385 + 68 NuclAT_15 - Antitoxin
- 547318..547385 + 68 NuclAT_15 - Antitoxin
- 547318..547385 + 68 NuclAT_17 - Antitoxin
- 547318..547385 + 68 NuclAT_17 - Antitoxin
- 547318..547385 + 68 NuclAT_17 - Antitoxin
- 547318..547385 + 68 NuclAT_17 - Antitoxin
- 547318..547385 + 68 NuclAT_19 - Antitoxin
- 547318..547385 + 68 NuclAT_19 - Antitoxin
- 547318..547385 + 68 NuclAT_19 - Antitoxin
- 547318..547385 + 68 NuclAT_19 - Antitoxin
- 547318..547385 + 68 NuclAT_21 - Antitoxin
- 547318..547385 + 68 NuclAT_21 - Antitoxin
- 547318..547385 + 68 NuclAT_21 - Antitoxin
- 547318..547385 + 68 NuclAT_21 - Antitoxin
- 547318..547385 + 68 NuclAT_23 - Antitoxin
- 547318..547385 + 68 NuclAT_23 - Antitoxin
- 547318..547385 + 68 NuclAT_23 - Antitoxin
- 547318..547385 + 68 NuclAT_23 - Antitoxin
BZY78_RS02815 547675..548775 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
BZY78_RS02820 549045..549275 + 231 WP_001146442.1 putative cation transport regulator ChaB -
BZY78_RS02825 549433..550128 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
BZY78_RS02830 550172..550525 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
BZY78_RS02835 550710..552104 + 1395 WP_000086213.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T72629 WP_000170965.1 NZ_CP019560:c547270-547163 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T72629 NZ_CP019560:c547270-547163 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT72629 NZ_CP019560:547318-547385 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References