Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1622683..1622905 | Replicon | chromosome |
| Accession | NZ_CP019455 | ||
| Organism | Escherichia coli strain FHI_NMBU_03 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A0D6GD35 |
| Locus tag | BXO92_RS24835 | Protein ID | WP_000170745.1 |
| Coordinates | 1622683..1622790 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1622847..1622905 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BXO92_RS08175 | 1617736..1617924 | - | 189 | WP_001063314.1 | YhjR family protein | - |
| BXO92_RS08180 | 1618197..1619768 | + | 1572 | WP_001204945.1 | cellulose biosynthesis protein BcsE | - |
| BXO92_RS08185 | 1619765..1619956 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| BXO92_RS08190 | 1619953..1621632 | + | 1680 | WP_024223715.1 | cellulose biosynthesis protein BcsG | - |
| BXO92_RS08195 | 1621718..1621825 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| BXO92_RS24830 | 1622201..1622308 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| BXO92_RS24835 | 1622683..1622790 | - | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1622847..1622905 | + | 59 | - | - | Antitoxin |
| BXO92_RS08225 | 1623266..1624537 | + | 1272 | WP_014640225.1 | amino acid permease | - |
| BXO92_RS08230 | 1624567..1625571 | - | 1005 | WP_000103579.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| BXO92_RS08235 | 1625568..1626551 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| BXO92_RS08240 | 1626562..1627464 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3855.68 Da Isoelectric Point: 9.0157
>T72482 WP_000170745.1 NZ_CP019455:c1622790-1622683 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK
Download Length: 108 bp
>T72482 NZ_CP019455:c1622790-1622683 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT72482 NZ_CP019455:1622847-1622905 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|