Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3144469..3144690 | Replicon | chromosome |
Accession | NZ_CP019392 | ||
Organism | Escherichia coli strain XH992 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
Locus tag | BW707_RS14910 | Protein ID | WP_000176713.1 |
Coordinates | 3144469..3144576 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3144624..3144690 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BW707_RS14885 | 3140313..3141395 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
BW707_RS14890 | 3141395..3142228 | + | 834 | WP_000456446.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
BW707_RS14895 | 3142225..3142617 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
BW707_RS14900 | 3142621..3143430 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
BW707_RS14905 | 3143466..3144320 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
BW707_RS14910 | 3144469..3144576 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 3144624..3144690 | + | 67 | NuclAT_13 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_13 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_13 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_13 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_15 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_15 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_15 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_15 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_17 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_17 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_17 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_17 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_19 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_19 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_19 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_19 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_21 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_21 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_21 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_21 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_23 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_23 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_23 | - | Antitoxin |
- | 3144624..3144690 | + | 67 | NuclAT_23 | - | Antitoxin |
- | 3144626..3144689 | + | 64 | NuclAT_51 | - | - |
- | 3144626..3144689 | + | 64 | NuclAT_51 | - | - |
- | 3144626..3144689 | + | 64 | NuclAT_51 | - | - |
- | 3144626..3144689 | + | 64 | NuclAT_51 | - | - |
BW707_RS14915 | 3145004..3145111 | - | 108 | WP_000170956.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 3145164..3145225 | + | 62 | NuclAT_50 | - | - |
- | 3145164..3145225 | + | 62 | NuclAT_50 | - | - |
- | 3145164..3145225 | + | 62 | NuclAT_50 | - | - |
- | 3145164..3145225 | + | 62 | NuclAT_50 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_14 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_14 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_14 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_14 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_16 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_16 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_16 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_16 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_18 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_18 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_18 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_18 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_20 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_20 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_20 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_20 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_22 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_22 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_22 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_22 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_24 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_24 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_24 | - | - |
- | 3145164..3145226 | + | 63 | NuclAT_24 | - | - |
BW707_RS14920 | 3145517..3146617 | - | 1101 | WP_001317783.1 | sodium-potassium/proton antiporter ChaA | - |
BW707_RS14925 | 3146887..3147117 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
BW707_RS14930 | 3147275..3147970 | + | 696 | WP_012311798.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
BW707_RS14935 | 3148014..3148367 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T72371 WP_000176713.1 NZ_CP019392:c3144576-3144469 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T72371 NZ_CP019392:c3144576-3144469 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT72371 NZ_CP019392:3144624-3144690 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|