72371

Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3144469..3144690 Replicon chromosome
Accession NZ_CP019392
Organism Escherichia coli strain XH992

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag BW707_RS14910 Protein ID WP_000176713.1
Coordinates 3144469..3144576 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3144624..3144690 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BW707_RS14885 3140313..3141395 + 1083 WP_000804726.1 peptide chain release factor 1 -
BW707_RS14890 3141395..3142228 + 834 WP_000456446.1 peptide chain release factor N(5)-glutamine methyltransferase -
BW707_RS14895 3142225..3142617 + 393 WP_000200374.1 invasion regulator SirB2 -
BW707_RS14900 3142621..3143430 + 810 WP_001257044.1 invasion regulator SirB1 -
BW707_RS14905 3143466..3144320 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
BW707_RS14910 3144469..3144576 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3144624..3144690 + 67 NuclAT_13 - Antitoxin
- 3144624..3144690 + 67 NuclAT_13 - Antitoxin
- 3144624..3144690 + 67 NuclAT_13 - Antitoxin
- 3144624..3144690 + 67 NuclAT_13 - Antitoxin
- 3144624..3144690 + 67 NuclAT_15 - Antitoxin
- 3144624..3144690 + 67 NuclAT_15 - Antitoxin
- 3144624..3144690 + 67 NuclAT_15 - Antitoxin
- 3144624..3144690 + 67 NuclAT_15 - Antitoxin
- 3144624..3144690 + 67 NuclAT_17 - Antitoxin
- 3144624..3144690 + 67 NuclAT_17 - Antitoxin
- 3144624..3144690 + 67 NuclAT_17 - Antitoxin
- 3144624..3144690 + 67 NuclAT_17 - Antitoxin
- 3144624..3144690 + 67 NuclAT_19 - Antitoxin
- 3144624..3144690 + 67 NuclAT_19 - Antitoxin
- 3144624..3144690 + 67 NuclAT_19 - Antitoxin
- 3144624..3144690 + 67 NuclAT_19 - Antitoxin
- 3144624..3144690 + 67 NuclAT_21 - Antitoxin
- 3144624..3144690 + 67 NuclAT_21 - Antitoxin
- 3144624..3144690 + 67 NuclAT_21 - Antitoxin
- 3144624..3144690 + 67 NuclAT_21 - Antitoxin
- 3144624..3144690 + 67 NuclAT_23 - Antitoxin
- 3144624..3144690 + 67 NuclAT_23 - Antitoxin
- 3144624..3144690 + 67 NuclAT_23 - Antitoxin
- 3144624..3144690 + 67 NuclAT_23 - Antitoxin
- 3144626..3144689 + 64 NuclAT_51 - -
- 3144626..3144689 + 64 NuclAT_51 - -
- 3144626..3144689 + 64 NuclAT_51 - -
- 3144626..3144689 + 64 NuclAT_51 - -
BW707_RS14915 3145004..3145111 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3145164..3145225 + 62 NuclAT_50 - -
- 3145164..3145225 + 62 NuclAT_50 - -
- 3145164..3145225 + 62 NuclAT_50 - -
- 3145164..3145225 + 62 NuclAT_50 - -
- 3145164..3145226 + 63 NuclAT_14 - -
- 3145164..3145226 + 63 NuclAT_14 - -
- 3145164..3145226 + 63 NuclAT_14 - -
- 3145164..3145226 + 63 NuclAT_14 - -
- 3145164..3145226 + 63 NuclAT_16 - -
- 3145164..3145226 + 63 NuclAT_16 - -
- 3145164..3145226 + 63 NuclAT_16 - -
- 3145164..3145226 + 63 NuclAT_16 - -
- 3145164..3145226 + 63 NuclAT_18 - -
- 3145164..3145226 + 63 NuclAT_18 - -
- 3145164..3145226 + 63 NuclAT_18 - -
- 3145164..3145226 + 63 NuclAT_18 - -
- 3145164..3145226 + 63 NuclAT_20 - -
- 3145164..3145226 + 63 NuclAT_20 - -
- 3145164..3145226 + 63 NuclAT_20 - -
- 3145164..3145226 + 63 NuclAT_20 - -
- 3145164..3145226 + 63 NuclAT_22 - -
- 3145164..3145226 + 63 NuclAT_22 - -
- 3145164..3145226 + 63 NuclAT_22 - -
- 3145164..3145226 + 63 NuclAT_22 - -
- 3145164..3145226 + 63 NuclAT_24 - -
- 3145164..3145226 + 63 NuclAT_24 - -
- 3145164..3145226 + 63 NuclAT_24 - -
- 3145164..3145226 + 63 NuclAT_24 - -
BW707_RS14920 3145517..3146617 - 1101 WP_001317783.1 sodium-potassium/proton antiporter ChaA -
BW707_RS14925 3146887..3147117 + 231 WP_001146444.1 putative cation transport regulator ChaB -
BW707_RS14930 3147275..3147970 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
BW707_RS14935 3148014..3148367 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T72371 WP_000176713.1 NZ_CP019392:c3144576-3144469 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T72371 NZ_CP019392:c3144576-3144469 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT72371 NZ_CP019392:3144624-3144690 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8


Antitoxin

Download structure file

References