Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 171260..171529 | Replicon | plasmid pXH993 |
Accession | NZ_CP019360 | ||
Organism | Escherichia coli strain XH993 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | BW158_RS00910 | Protein ID | WP_001312861.1 |
Coordinates | 171371..171529 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 171260..171325 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BW158_RS00870 | 166479..167450 | + | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
BW158_RS00875 | 168589..168795 | + | 207 | WP_000275856.1 | hypothetical protein | - |
BW158_RS00880 | 168821..169360 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
BW158_RS00885 | 169428..169661 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
BW158_RS00890 | 169689..169886 | + | 198 | Protein_177 | hypothetical protein | - |
BW158_RS00895 | 169941..170375 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
BW158_RS00900 | 170372..171091 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
BW158_RS00905 | 171103..171291 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 171103..171327 | + | 225 | NuclAT_0 | - | - |
- | 171103..171327 | + | 225 | NuclAT_0 | - | - |
- | 171103..171327 | + | 225 | NuclAT_0 | - | - |
- | 171103..171327 | + | 225 | NuclAT_0 | - | - |
- | 171260..171325 | + | 66 | - | - | Antitoxin |
BW158_RS00910 | 171371..171529 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BW158_RS00915 | 172450..172737 | + | 288 | WP_000107535.1 | hypothetical protein | - |
BW158_RS00920 | 172855..173676 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
BW158_RS00925 | 173973..174575 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
BW158_RS00930 | 174896..175279 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
BW158_RS00935 | 175466..176155 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | oqxB / oqxA / aac(3)-IId / sitABCD / mph(A) / aph(3')-Ia / sul2 / aph(4)-Ia / aac(3)-IVa / blaCTX-M-14 / fosA3 / mcr-1.1 | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..349248 | 349248 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T72320 WP_001312861.1 NZ_CP019360:171371-171529 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T72320 NZ_CP019360:171371-171529 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT72320 NZ_CP019360:171260-171325 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|