Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 78739..79003 | Replicon | plasmid pXH990_3 |
Accession | NZ_CP019358 | ||
Organism | Escherichia coli strain XH990 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | BW242_RS02330 | Protein ID | WP_001387489.1 |
Coordinates | 78739..78891 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 78943..79003 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BW242_RS02300 | 74005..76173 | + | 2169 | WP_015508354.1 | DotA/TraY family protein | - |
BW242_RS02305 | 76244..76906 | + | 663 | WP_012783935.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
BW242_RS02310 | 76978..77187 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
BW242_RS02315 | 77579..77755 | + | 177 | WP_001054900.1 | hypothetical protein | - |
BW242_RS02320 | 77820..78116 | - | 297 | WP_011264046.1 | hypothetical protein | - |
BW242_RS02325 | 78416..78667 | + | 252 | Protein_91 | hypothetical protein | - |
BW242_RS02330 | 78739..78891 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
- | 78943..79003 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 78943..79003 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 78943..79003 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 78943..79003 | + | 61 | NuclAT_0 | - | Antitoxin |
BW242_RS02335 | 79206..80297 | + | 1092 | WP_000426061.1 | hypothetical protein | - |
- | 80367..80424 | + | 58 | NuclAT_1 | - | - |
- | 80367..80424 | + | 58 | NuclAT_1 | - | - |
- | 80367..80424 | + | 58 | NuclAT_1 | - | - |
- | 80367..80424 | + | 58 | NuclAT_1 | - | - |
BW242_RS02340 | 80604..81812 | + | 1209 | WP_001703845.1 | IncI1-type conjugal transfer protein TrbA | - |
BW242_RS02345 | 81831..82901 | + | 1071 | WP_012783932.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-55 | - | 1..86028 | 86028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T72296 WP_001387489.1 NZ_CP019358:c78891-78739 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T72296 NZ_CP019358:c78891-78739 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT72296 NZ_CP019358:78943-79003 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|