Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 110639..110908 | Replicon | plasmid p13P484A-2 |
| Accession | NZ_CP019282 | ||
| Organism | Escherichia coli strain 13P484A | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BWI90_RS25815 | Protein ID | WP_001312861.1 |
| Coordinates | 110750..110908 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 110639..110704 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWI90_RS25775 | 105858..106829 | + | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
| BWI90_RS27960 | 107968..108174 | + | 207 | WP_000275856.1 | hypothetical protein | - |
| BWI90_RS25790 | 108200..108739 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| BWI90_RS25795 | 108807..109040 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
| BWI90_RS25800 | 109068..109265 | + | 198 | Protein_113 | hypothetical protein | - |
| BWI90_RS25805 | 109320..109754 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| BWI90_RS25810 | 109751..110470 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| BWI90_RS27730 | 110482..110670 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 110482..110706 | + | 225 | NuclAT_0 | - | - |
| - | 110482..110706 | + | 225 | NuclAT_0 | - | - |
| - | 110482..110706 | + | 225 | NuclAT_0 | - | - |
| - | 110482..110706 | + | 225 | NuclAT_0 | - | - |
| - | 110639..110704 | + | 66 | - | - | Antitoxin |
| BWI90_RS25815 | 110750..110908 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| BWI90_RS25830 | 111829..112116 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| BWI90_RS25835 | 112234..113055 | + | 822 | Protein_119 | DUF932 domain-containing protein | - |
| BWI90_RS25840 | 113352..113954 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| BWI90_RS25845 | 114275..114658 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| BWI90_RS25850 | 114845..115534 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / blaCTX-M-15 / fosA3 / mph(A) / qacE / aadA2 / dfrA12 / oqxB / oqxA / tet(A) / sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..149520 | 149520 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T72211 WP_001312861.1 NZ_CP019282:110750-110908 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T72211 NZ_CP019282:110750-110908 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT72211 NZ_CP019282:110639-110704 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|