Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4458389..4458609 Replicon chromosome
Accession NZ_CP019271
Organism Escherichia coli strain 13P460A

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag BWI88_RS22805 Protein ID WP_000170965.1
Coordinates 4458502..4458609 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4458389..4458455 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BWI88_RS22780 4453668..4455062 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
BWI88_RS22785 4455247..4455600 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
BWI88_RS22790 4455644..4456339 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
BWI88_RS22795 4456497..4456727 - 231 WP_001146442.1 putative cation transport regulator ChaB -
BWI88_RS22800 4456997..4458097 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 4458389..4458455 - 67 - - Antitoxin
BWI88_RS22805 4458502..4458609 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4458922..4458985 - 64 NuclAT_33 - -
- 4458922..4458985 - 64 NuclAT_33 - -
- 4458922..4458985 - 64 NuclAT_33 - -
- 4458922..4458985 - 64 NuclAT_33 - -
- 4458922..4458985 - 64 NuclAT_36 - -
- 4458922..4458985 - 64 NuclAT_36 - -
- 4458922..4458985 - 64 NuclAT_36 - -
- 4458922..4458985 - 64 NuclAT_36 - -
- 4458922..4458985 - 64 NuclAT_39 - -
- 4458922..4458985 - 64 NuclAT_39 - -
- 4458922..4458985 - 64 NuclAT_39 - -
- 4458922..4458985 - 64 NuclAT_39 - -
- 4458922..4458985 - 64 NuclAT_42 - -
- 4458922..4458985 - 64 NuclAT_42 - -
- 4458922..4458985 - 64 NuclAT_42 - -
- 4458922..4458985 - 64 NuclAT_42 - -
- 4458922..4458985 - 64 NuclAT_45 - -
- 4458922..4458985 - 64 NuclAT_45 - -
- 4458922..4458985 - 64 NuclAT_45 - -
- 4458922..4458985 - 64 NuclAT_45 - -
- 4458922..4458985 - 64 NuclAT_48 - -
- 4458922..4458985 - 64 NuclAT_48 - -
- 4458922..4458985 - 64 NuclAT_48 - -
- 4458922..4458985 - 64 NuclAT_48 - -
- 4458923..4458985 - 63 NuclAT_50 - -
- 4458923..4458985 - 63 NuclAT_50 - -
- 4458923..4458985 - 63 NuclAT_50 - -
- 4458923..4458985 - 63 NuclAT_50 - -
- 4458923..4458985 - 63 NuclAT_53 - -
- 4458923..4458985 - 63 NuclAT_53 - -
- 4458923..4458985 - 63 NuclAT_53 - -
- 4458923..4458985 - 63 NuclAT_53 - -
- 4458923..4458985 - 63 NuclAT_56 - -
- 4458923..4458985 - 63 NuclAT_56 - -
- 4458923..4458985 - 63 NuclAT_56 - -
- 4458923..4458985 - 63 NuclAT_56 - -
- 4458924..4458985 - 62 NuclAT_15 - -
- 4458924..4458985 - 62 NuclAT_15 - -
- 4458924..4458985 - 62 NuclAT_15 - -
- 4458924..4458985 - 62 NuclAT_15 - -
- 4458924..4458985 - 62 NuclAT_18 - -
- 4458924..4458985 - 62 NuclAT_18 - -
- 4458924..4458985 - 62 NuclAT_18 - -
- 4458924..4458985 - 62 NuclAT_18 - -
- 4458924..4458985 - 62 NuclAT_21 - -
- 4458924..4458985 - 62 NuclAT_21 - -
- 4458924..4458985 - 62 NuclAT_21 - -
- 4458924..4458985 - 62 NuclAT_21 - -
- 4458924..4458985 - 62 NuclAT_24 - -
- 4458924..4458985 - 62 NuclAT_24 - -
- 4458924..4458985 - 62 NuclAT_24 - -
- 4458924..4458985 - 62 NuclAT_24 - -
- 4458924..4458985 - 62 NuclAT_27 - -
- 4458924..4458985 - 62 NuclAT_27 - -
- 4458924..4458985 - 62 NuclAT_27 - -
- 4458924..4458985 - 62 NuclAT_27 - -
- 4458924..4458985 - 62 NuclAT_30 - -
- 4458924..4458985 - 62 NuclAT_30 - -
- 4458924..4458985 - 62 NuclAT_30 - -
- 4458924..4458985 - 62 NuclAT_30 - -
BWI88_RS22810 4459038..4459145 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4459458..4459523 - 66 NuclAT_32 - -
- 4459458..4459523 - 66 NuclAT_32 - -
- 4459458..4459523 - 66 NuclAT_32 - -
- 4459458..4459523 - 66 NuclAT_32 - -
- 4459458..4459523 - 66 NuclAT_35 - -
- 4459458..4459523 - 66 NuclAT_35 - -
- 4459458..4459523 - 66 NuclAT_35 - -
- 4459458..4459523 - 66 NuclAT_35 - -
- 4459458..4459523 - 66 NuclAT_38 - -
- 4459458..4459523 - 66 NuclAT_38 - -
- 4459458..4459523 - 66 NuclAT_38 - -
- 4459458..4459523 - 66 NuclAT_38 - -
- 4459458..4459523 - 66 NuclAT_41 - -
- 4459458..4459523 - 66 NuclAT_41 - -
- 4459458..4459523 - 66 NuclAT_41 - -
- 4459458..4459523 - 66 NuclAT_41 - -
- 4459458..4459523 - 66 NuclAT_44 - -
- 4459458..4459523 - 66 NuclAT_44 - -
- 4459458..4459523 - 66 NuclAT_44 - -
- 4459458..4459523 - 66 NuclAT_44 - -
- 4459458..4459523 - 66 NuclAT_47 - -
- 4459458..4459523 - 66 NuclAT_47 - -
- 4459458..4459523 - 66 NuclAT_47 - -
- 4459458..4459523 - 66 NuclAT_47 - -
- 4459459..4459525 - 67 NuclAT_49 - -
- 4459459..4459525 - 67 NuclAT_49 - -
- 4459459..4459525 - 67 NuclAT_49 - -
- 4459459..4459525 - 67 NuclAT_49 - -
- 4459459..4459525 - 67 NuclAT_52 - -
- 4459459..4459525 - 67 NuclAT_52 - -
- 4459459..4459525 - 67 NuclAT_52 - -
- 4459459..4459525 - 67 NuclAT_52 - -
- 4459459..4459525 - 67 NuclAT_55 - -
- 4459459..4459525 - 67 NuclAT_55 - -
- 4459459..4459525 - 67 NuclAT_55 - -
- 4459459..4459525 - 67 NuclAT_55 - -
- 4459460..4459523 - 64 NuclAT_14 - -
- 4459460..4459523 - 64 NuclAT_14 - -
- 4459460..4459523 - 64 NuclAT_14 - -
- 4459460..4459523 - 64 NuclAT_14 - -
- 4459460..4459523 - 64 NuclAT_17 - -
- 4459460..4459523 - 64 NuclAT_17 - -
- 4459460..4459523 - 64 NuclAT_17 - -
- 4459460..4459523 - 64 NuclAT_17 - -
- 4459460..4459523 - 64 NuclAT_20 - -
- 4459460..4459523 - 64 NuclAT_20 - -
- 4459460..4459523 - 64 NuclAT_20 - -
- 4459460..4459523 - 64 NuclAT_20 - -
- 4459460..4459523 - 64 NuclAT_23 - -
- 4459460..4459523 - 64 NuclAT_23 - -
- 4459460..4459523 - 64 NuclAT_23 - -
- 4459460..4459523 - 64 NuclAT_23 - -
- 4459460..4459523 - 64 NuclAT_26 - -
- 4459460..4459523 - 64 NuclAT_26 - -
- 4459460..4459523 - 64 NuclAT_26 - -
- 4459460..4459523 - 64 NuclAT_26 - -
- 4459460..4459523 - 64 NuclAT_29 - -
- 4459460..4459523 - 64 NuclAT_29 - -
- 4459460..4459523 - 64 NuclAT_29 - -
- 4459460..4459523 - 64 NuclAT_29 - -
BWI88_RS26635 4459573..4459680 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
BWI88_RS22820 4459829..4460683 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
BWI88_RS22825 4460719..4461528 - 810 WP_148125509.1 invasion regulator SirB1 -
BWI88_RS22830 4461532..4461924 - 393 WP_000200392.1 invasion regulator SirB2 -
BWI88_RS22835 4461921..4462754 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T72132 WP_000170965.1 NZ_CP019271:4458502-4458609 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T72132 NZ_CP019271:4458502-4458609 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT72132 NZ_CP019271:c4458455-4458389 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References