Detailed information of TA system TA072101

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 20699..20952
• Replicon: plasmid p13C1079T-2
• Accession: NZ_CP019269
• Organism: Escherichia coli strain 13C1079T

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: BWI87_RS25405
• Protein ID: WP_001312851.1
• Coordinates: 20699..20848 (-)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	20893..20952 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BWI87_RS25355	16058..16473	-	416	Protein_18	IS1 family transposase	-
BWI87_RS25370	16722..17123	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
BWI87_RS26050	17056..17313	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
BWI87_RS25375	17406..18059	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
BWI87_RS25385	18998..19855	-	858	WP_032495102.1	incFII family plasmid replication initiator RepA	-
BWI87_RS25390	19848..19922	-	75	WP_001375168.1	RepA leader peptide Tap	-
BWI87_RS25400	20167..20415	-	249	WP_000083837.1	replication regulatory protein RepA	-
BWI87_RS25405	20699..20848	-	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	20893..20952	+	60	NuclAT_0	-	Antitoxin
-	20893..20952	+	60	NuclAT_0	-	Antitoxin
-	20893..20952	+	60	NuclAT_0	-	Antitoxin
-	20893..20952	+	60	NuclAT_0	-	Antitoxin
BWI87_RS25420	21575..22000	+	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
BWI87_RS25425	21997..22347	+	351	WP_001565133.1	IS66 family insertion sequence element accessory protein TnpB	-
BWI87_RS25430	22378..23193	+	816	Protein_28	IS66-like element ISEc23 family transposase	-
BWI87_RS25435	23234..23563	-	330	Protein_29	conjugal transfer protein TraD	-
BWI87_RS26055	23490..23792	-	303	WP_158665941.1	type IV secretion system DNA-binding domain-containing protein	-
BWI87_RS25445	23818..24009	-	192	WP_001027493.1	hypothetical protein	-
BWI87_RS25450	24006..24428	-	423	WP_000271762.1	DUF1380 family protein	-
BWI87_RS25455	24475..24762	-	288	WP_148116131.1	antirestriction protein	-
BWI87_RS25460	24714..25166	-	453	Protein_34	DNA methylase	-
BWI87_RS25465	25243..25536	-	294	WP_032146011.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	blaCTX-M-55 / blaTEM-1B / fosA3	-	1..65009	65009

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T72101 WP_001312851.1 NZ_CP019269:c20848-20699 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T72101 NZ_CP019269:c20848-20699 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT72101 NZ_CP019269:20893-20952 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin