Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 114110..114379 | Replicon | plasmid p13C1079T-1 |
Accession | NZ_CP019268 | ||
Organism | Escherichia coli strain 13C1079T |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | BWI87_RS25155 | Protein ID | WP_001312861.1 |
Coordinates | 114221..114379 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 114110..114175 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BWI87_RS25115 | 109329..110300 | + | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
BWI87_RS26195 | 111439..111645 | + | 207 | WP_000275856.1 | hypothetical protein | - |
BWI87_RS25130 | 111671..112210 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
BWI87_RS25135 | 112278..112511 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
BWI87_RS25140 | 112539..112736 | + | 198 | Protein_112 | hypothetical protein | - |
BWI87_RS25145 | 112791..113225 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
BWI87_RS25150 | 113222..113941 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
BWI87_RS26040 | 113953..114141 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 113953..114177 | + | 225 | NuclAT_0 | - | - |
- | 113953..114177 | + | 225 | NuclAT_0 | - | - |
- | 113953..114177 | + | 225 | NuclAT_0 | - | - |
- | 113953..114177 | + | 225 | NuclAT_0 | - | - |
- | 114110..114175 | + | 66 | - | - | Antitoxin |
BWI87_RS25155 | 114221..114379 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BWI87_RS25170 | 115300..115587 | + | 288 | WP_000107535.1 | hypothetical protein | - |
BWI87_RS25175 | 115705..116526 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
BWI87_RS25180 | 116824..117426 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
BWI87_RS25185 | 117747..118130 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
BWI87_RS25190 | 118317..119006 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / catA1 / tet(B) / blaTEM-1B / oqxB / oqxA / sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..125272 | 125272 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T72097 WP_001312861.1 NZ_CP019268:114221-114379 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T72097 NZ_CP019268:114221-114379 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT72097 NZ_CP019268:114110-114175 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|