Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2614060..2614280 Replicon chromosome
Accession NZ_CP019267
Organism Escherichia coli strain 13C1079T

Toxin (Protein)


Gene name ldrD Uniprot ID A0A8S7XT81
Locus tag BWI87_RS13400 Protein ID WP_074147554.1
Coordinates 2614060..2614167 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2614214..2614280 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BWI87_RS13365 2609915..2610748 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
BWI87_RS13370 2610745..2611137 + 393 WP_000200378.1 invasion regulator SirB2 -
BWI87_RS13375 2611141..2611950 + 810 WP_001257044.1 invasion regulator SirB1 -
BWI87_RS13380 2611986..2612840 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
BWI87_RS13385 2612989..2613096 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2613144..2613210 + 67 NuclAT_51 - -
- 2613144..2613210 + 67 NuclAT_51 - -
- 2613144..2613210 + 67 NuclAT_51 - -
- 2613144..2613210 + 67 NuclAT_51 - -
- 2613144..2613210 + 67 NuclAT_54 - -
- 2613144..2613210 + 67 NuclAT_54 - -
- 2613144..2613210 + 67 NuclAT_54 - -
- 2613144..2613210 + 67 NuclAT_54 - -
- 2613146..2613209 + 64 NuclAT_16 - -
- 2613146..2613209 + 64 NuclAT_16 - -
- 2613146..2613209 + 64 NuclAT_16 - -
- 2613146..2613209 + 64 NuclAT_16 - -
- 2613146..2613209 + 64 NuclAT_19 - -
- 2613146..2613209 + 64 NuclAT_19 - -
- 2613146..2613209 + 64 NuclAT_19 - -
- 2613146..2613209 + 64 NuclAT_19 - -
- 2613146..2613209 + 64 NuclAT_22 - -
- 2613146..2613209 + 64 NuclAT_22 - -
- 2613146..2613209 + 64 NuclAT_22 - -
- 2613146..2613209 + 64 NuclAT_22 - -
- 2613146..2613209 + 64 NuclAT_25 - -
- 2613146..2613209 + 64 NuclAT_25 - -
- 2613146..2613209 + 64 NuclAT_25 - -
- 2613146..2613209 + 64 NuclAT_25 - -
- 2613146..2613209 + 64 NuclAT_28 - -
- 2613146..2613209 + 64 NuclAT_28 - -
- 2613146..2613209 + 64 NuclAT_28 - -
- 2613146..2613209 + 64 NuclAT_28 - -
- 2613146..2613209 + 64 NuclAT_31 - -
- 2613146..2613209 + 64 NuclAT_31 - -
- 2613146..2613209 + 64 NuclAT_31 - -
- 2613146..2613209 + 64 NuclAT_31 - -
- 2613146..2613211 + 66 NuclAT_34 - -
- 2613146..2613211 + 66 NuclAT_34 - -
- 2613146..2613211 + 66 NuclAT_34 - -
- 2613146..2613211 + 66 NuclAT_34 - -
- 2613146..2613211 + 66 NuclAT_37 - -
- 2613146..2613211 + 66 NuclAT_37 - -
- 2613146..2613211 + 66 NuclAT_37 - -
- 2613146..2613211 + 66 NuclAT_37 - -
- 2613146..2613211 + 66 NuclAT_40 - -
- 2613146..2613211 + 66 NuclAT_40 - -
- 2613146..2613211 + 66 NuclAT_40 - -
- 2613146..2613211 + 66 NuclAT_40 - -
- 2613146..2613211 + 66 NuclAT_43 - -
- 2613146..2613211 + 66 NuclAT_43 - -
- 2613146..2613211 + 66 NuclAT_43 - -
- 2613146..2613211 + 66 NuclAT_43 - -
- 2613146..2613211 + 66 NuclAT_46 - -
- 2613146..2613211 + 66 NuclAT_46 - -
- 2613146..2613211 + 66 NuclAT_46 - -
- 2613146..2613211 + 66 NuclAT_46 - -
- 2613146..2613211 + 66 NuclAT_49 - -
- 2613146..2613211 + 66 NuclAT_49 - -
- 2613146..2613211 + 66 NuclAT_49 - -
- 2613146..2613211 + 66 NuclAT_49 - -
BWI87_RS13390 2613524..2613631 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2613684..2613745 + 62 NuclAT_17 - -
- 2613684..2613745 + 62 NuclAT_17 - -
- 2613684..2613745 + 62 NuclAT_17 - -
- 2613684..2613745 + 62 NuclAT_17 - -
- 2613684..2613745 + 62 NuclAT_20 - -
- 2613684..2613745 + 62 NuclAT_20 - -
- 2613684..2613745 + 62 NuclAT_20 - -
- 2613684..2613745 + 62 NuclAT_20 - -
- 2613684..2613745 + 62 NuclAT_23 - -
- 2613684..2613745 + 62 NuclAT_23 - -
- 2613684..2613745 + 62 NuclAT_23 - -
- 2613684..2613745 + 62 NuclAT_23 - -
- 2613684..2613745 + 62 NuclAT_26 - -
- 2613684..2613745 + 62 NuclAT_26 - -
- 2613684..2613745 + 62 NuclAT_26 - -
- 2613684..2613745 + 62 NuclAT_26 - -
- 2613684..2613745 + 62 NuclAT_29 - -
- 2613684..2613745 + 62 NuclAT_29 - -
- 2613684..2613745 + 62 NuclAT_29 - -
- 2613684..2613745 + 62 NuclAT_29 - -
- 2613684..2613745 + 62 NuclAT_32 - -
- 2613684..2613745 + 62 NuclAT_32 - -
- 2613684..2613745 + 62 NuclAT_32 - -
- 2613684..2613745 + 62 NuclAT_32 - -
- 2613684..2613746 + 63 NuclAT_52 - -
- 2613684..2613746 + 63 NuclAT_52 - -
- 2613684..2613746 + 63 NuclAT_52 - -
- 2613684..2613746 + 63 NuclAT_52 - -
- 2613684..2613746 + 63 NuclAT_55 - -
- 2613684..2613746 + 63 NuclAT_55 - -
- 2613684..2613746 + 63 NuclAT_55 - -
- 2613684..2613746 + 63 NuclAT_55 - -
- 2613684..2613747 + 64 NuclAT_35 - -
- 2613684..2613747 + 64 NuclAT_35 - -
- 2613684..2613747 + 64 NuclAT_35 - -
- 2613684..2613747 + 64 NuclAT_35 - -
- 2613684..2613747 + 64 NuclAT_38 - -
- 2613684..2613747 + 64 NuclAT_38 - -
- 2613684..2613747 + 64 NuclAT_38 - -
- 2613684..2613747 + 64 NuclAT_38 - -
- 2613684..2613747 + 64 NuclAT_41 - -
- 2613684..2613747 + 64 NuclAT_41 - -
- 2613684..2613747 + 64 NuclAT_41 - -
- 2613684..2613747 + 64 NuclAT_41 - -
- 2613684..2613747 + 64 NuclAT_44 - -
- 2613684..2613747 + 64 NuclAT_44 - -
- 2613684..2613747 + 64 NuclAT_44 - -
- 2613684..2613747 + 64 NuclAT_44 - -
- 2613684..2613747 + 64 NuclAT_47 - -
- 2613684..2613747 + 64 NuclAT_47 - -
- 2613684..2613747 + 64 NuclAT_47 - -
- 2613684..2613747 + 64 NuclAT_47 - -
- 2613684..2613747 + 64 NuclAT_50 - -
- 2613684..2613747 + 64 NuclAT_50 - -
- 2613684..2613747 + 64 NuclAT_50 - -
- 2613684..2613747 + 64 NuclAT_50 - -
BWI87_RS13400 2614060..2614167 - 108 WP_074147554.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2614214..2614280 + 67 - - Antitoxin
BWI87_RS13405 2614572..2615672 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
BWI87_RS13410 2615942..2616172 + 231 WP_001146442.1 putative cation transport regulator ChaB -
BWI87_RS13415 2616330..2617025 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
BWI87_RS13420 2617069..2617422 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
BWI87_RS13425 2617607..2619001 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T72075 WP_074147554.1 NZ_CP019267:c2614167-2614060 [Escherichia coli]
MTLAQFAMTFWHDLAAPILTGIITAAIVSWWRNRK

Download         Length: 108 bp

>T72075 NZ_CP019267:c2614167-2614060 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGACGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT72075 NZ_CP019267:2614214-2614280 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References