Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 2613524..2613745 | Replicon | chromosome |
Accession | NZ_CP019267 | ||
Organism | Escherichia coli strain 13C1079T |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | E0IV43 |
Locus tag | BWI87_RS13390 | Protein ID | WP_000170926.1 |
Coordinates | 2613524..2613631 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 2613684..2613745 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BWI87_RS13360 | 2608833..2609915 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
BWI87_RS13365 | 2609915..2610748 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
BWI87_RS13370 | 2610745..2611137 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
BWI87_RS13375 | 2611141..2611950 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
BWI87_RS13380 | 2611986..2612840 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
BWI87_RS13385 | 2612989..2613096 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 2613144..2613210 | + | 67 | NuclAT_51 | - | - |
- | 2613144..2613210 | + | 67 | NuclAT_51 | - | - |
- | 2613144..2613210 | + | 67 | NuclAT_51 | - | - |
- | 2613144..2613210 | + | 67 | NuclAT_51 | - | - |
- | 2613144..2613210 | + | 67 | NuclAT_54 | - | - |
- | 2613144..2613210 | + | 67 | NuclAT_54 | - | - |
- | 2613144..2613210 | + | 67 | NuclAT_54 | - | - |
- | 2613144..2613210 | + | 67 | NuclAT_54 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_16 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_16 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_16 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_16 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_19 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_19 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_19 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_19 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_22 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_22 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_22 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_22 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_25 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_25 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_25 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_25 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_28 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_28 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_28 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_28 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_31 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_31 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_31 | - | - |
- | 2613146..2613209 | + | 64 | NuclAT_31 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_34 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_34 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_34 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_34 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_37 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_37 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_37 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_37 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_40 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_40 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_40 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_40 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_43 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_43 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_43 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_43 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_46 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_46 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_46 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_46 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_49 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_49 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_49 | - | - |
- | 2613146..2613211 | + | 66 | NuclAT_49 | - | - |
BWI87_RS13390 | 2613524..2613631 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 2613684..2613745 | + | 62 | NuclAT_17 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_17 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_17 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_17 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_20 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_20 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_20 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_20 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_23 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_23 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_23 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_23 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_26 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_26 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_26 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_26 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_29 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_29 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_29 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_29 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_32 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_32 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_32 | - | Antitoxin |
- | 2613684..2613745 | + | 62 | NuclAT_32 | - | Antitoxin |
- | 2613684..2613746 | + | 63 | NuclAT_52 | - | - |
- | 2613684..2613746 | + | 63 | NuclAT_52 | - | - |
- | 2613684..2613746 | + | 63 | NuclAT_52 | - | - |
- | 2613684..2613746 | + | 63 | NuclAT_52 | - | - |
- | 2613684..2613746 | + | 63 | NuclAT_55 | - | - |
- | 2613684..2613746 | + | 63 | NuclAT_55 | - | - |
- | 2613684..2613746 | + | 63 | NuclAT_55 | - | - |
- | 2613684..2613746 | + | 63 | NuclAT_55 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_35 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_35 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_35 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_35 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_38 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_38 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_38 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_38 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_41 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_41 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_41 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_41 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_44 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_44 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_44 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_44 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_47 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_47 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_47 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_47 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_50 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_50 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_50 | - | - |
- | 2613684..2613747 | + | 64 | NuclAT_50 | - | - |
BWI87_RS13400 | 2614060..2614167 | - | 108 | WP_074147554.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 2614215..2614280 | + | 66 | NuclAT_15 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_15 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_15 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_15 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_18 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_18 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_18 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_18 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_21 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_21 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_21 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_21 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_24 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_24 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_24 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_24 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_27 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_27 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_27 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_27 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_30 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_30 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_30 | - | - |
- | 2614215..2614280 | + | 66 | NuclAT_30 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_33 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_33 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_33 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_33 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_36 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_36 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_36 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_36 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_39 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_39 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_39 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_39 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_42 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_42 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_42 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_42 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_45 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_45 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_45 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_45 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_48 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_48 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_48 | - | - |
- | 2614215..2614282 | + | 68 | NuclAT_48 | - | - |
- | 2614216..2614281 | + | 66 | NuclAT_53 | - | - |
- | 2614216..2614281 | + | 66 | NuclAT_53 | - | - |
- | 2614216..2614281 | + | 66 | NuclAT_53 | - | - |
- | 2614216..2614281 | + | 66 | NuclAT_53 | - | - |
- | 2614216..2614281 | + | 66 | NuclAT_56 | - | - |
- | 2614216..2614281 | + | 66 | NuclAT_56 | - | - |
- | 2614216..2614281 | + | 66 | NuclAT_56 | - | - |
- | 2614216..2614281 | + | 66 | NuclAT_56 | - | - |
BWI87_RS13405 | 2614572..2615672 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
BWI87_RS13410 | 2615942..2616172 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
BWI87_RS13415 | 2616330..2617025 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
BWI87_RS13420 | 2617069..2617422 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.84 Da Isoelectric Point: 11.6501
>T72071 WP_000170926.1 NZ_CP019267:c2613631-2613524 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T72071 NZ_CP019267:c2613631-2613524 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT72071 NZ_CP019267:2613684-2613745 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|