Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 30595..30849 | Replicon | plasmid p13C1065T-2 |
| Accession | NZ_CP019261 | ||
| Organism | Escherichia coli strain 13C1065T | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | BWI86_RS25780 | Protein ID | WP_001351576.1 |
| Coordinates | 30595..30801 (-) | Length | 69 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 30788..30849 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWI86_RS25730 | 26617..27117 | + | 501 | Protein_31 | Tn3 family transposase | - |
| BWI86_RS25735 | 27151..27339 | + | 189 | Protein_32 | IS3 family transposase | - |
| BWI86_RS25740 | 27414..27701 | - | 288 | WP_000222766.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| BWI86_RS25745 | 27698..27949 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| BWI86_RS25760 | 28917..29771 | - | 855 | Protein_35 | incFII family plasmid replication initiator RepA | - |
| BWI86_RS25765 | 29764..29838 | - | 75 | WP_061357229.1 | RepA leader peptide Tap | - |
| BWI86_RS25775 | 30070..30327 | - | 258 | WP_001541895.1 | replication regulatory protein RepA | - |
| BWI86_RS25780 | 30595..30801 | - | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 30788..30849 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 30788..30849 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 30788..30849 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 30788..30849 | + | 62 | NuclAT_1 | - | Antitoxin |
| BWI86_RS25790 | 31191..31403 | - | 213 | WP_001541896.1 | ANR family transcriptional regulator | - |
| BWI86_RS25795 | 31538..32098 | - | 561 | WP_000139310.1 | fertility inhibition protein FinO | - |
| BWI86_RS25800 | 32153..32896 | - | 744 | WP_039002216.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / sul2 / aph(3')-Ia / sul3 / blaTEM-1B / lnu(F) / ant(3'')-Ia / aac(3)-IId / tet(M) / cmlA1 / aadA2 / dfrA12 | - | 1..138610 | 138610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T72052 WP_001351576.1 NZ_CP019261:c30801-30595 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T72052 NZ_CP019261:c30801-30595 [Escherichia coli]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCAGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACTGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCAGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACTGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT72052 NZ_CP019261:30788-30849 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|