Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 112822..113091 | Replicon | plasmid pCombat13F7-2 |
| Accession | NZ_CP019247 | ||
| Organism | Escherichia coli strain Combat13F7 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BWI83_RS25385 | Protein ID | WP_001312861.1 |
| Coordinates | 112933..113091 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 112822..112887 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWI83_RS25340 | 107870..108142 | + | 273 | WP_072133095.1 | hypothetical protein | - |
| BWI83_RS25360 | 108615..109142 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| BWI83_RS25365 | 109198..109431 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| BWI83_RS25370 | 109490..111448 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| BWI83_RS25375 | 111503..111937 | + | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| BWI83_RS25380 | 111934..112653 | + | 720 | WP_001276228.1 | plasmid SOS inhibition protein A | - |
| BWI83_RS26830 | 112665..112853 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 112665..112889 | + | 225 | NuclAT_0 | - | - |
| - | 112665..112889 | + | 225 | NuclAT_0 | - | - |
| - | 112665..112889 | + | 225 | NuclAT_0 | - | - |
| - | 112665..112889 | + | 225 | NuclAT_0 | - | - |
| - | 112822..112887 | + | 66 | - | - | Antitoxin |
| BWI83_RS25385 | 112933..113091 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| BWI83_RS26980 | 113782..113988 | + | 207 | WP_000547939.1 | hypothetical protein | - |
| BWI83_RS25405 | 114013..114300 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| BWI83_RS25410 | 114423..115244 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| BWI83_RS25415 | 115541..116188 | - | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
| BWI83_RS25420 | 116465..116848 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| BWI83_RS25425 | 117039..117725 | + | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| BWI83_RS25430 | 117819..118046 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA1 / aadA1 / qacE / sul1 / mph(A) / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / oqxB / oqxA / tet(A) / sitABCD | iroN / iroE / iroD / iroC / iroB | 1..151049 | 151049 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T71962 WP_001312861.1 NZ_CP019247:112933-113091 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T71962 NZ_CP019247:112933-113091 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT71962 NZ_CP019247:112822-112887 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|