Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 27570..27840 | Replicon | plasmid pCombat2C1-1 |
| Accession | NZ_CP019244 | ||
| Organism | Escherichia coli strain Combat2C1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BWI82_RS27065 | Protein ID | WP_001312861.1 |
| Coordinates | 27682..27840 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 27570..27633 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWI82_RS27020 | 22624..22878 | + | 255 | WP_072254791.1 | hypothetical protein | - |
| BWI82_RS27825 | 23119..23325 | + | 207 | WP_000547944.1 | hypothetical protein | - |
| BWI82_RS27040 | 23351..23884 | + | 534 | WP_105906671.1 | single-stranded DNA-binding protein | - |
| BWI82_RS27045 | 23942..24175 | + | 234 | WP_000005998.1 | DUF905 family protein | - |
| BWI82_RS27050 | 24239..26197 | + | 1959 | WP_105272432.1 | ParB/RepB/Spo0J family partition protein | - |
| BWI82_RS27055 | 26252..26686 | + | 435 | WP_001470779.1 | conjugation system SOS inhibitor PsiB | - |
| BWI82_RS27060 | 26683..27402 | + | 720 | WP_105906669.1 | plasmid SOS inhibition protein A | - |
| BWI82_RS27610 | 27414..27602 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 27414..27638 | + | 225 | NuclAT_0 | - | - |
| - | 27414..27638 | + | 225 | NuclAT_0 | - | - |
| - | 27414..27638 | + | 225 | NuclAT_0 | - | - |
| - | 27414..27638 | + | 225 | NuclAT_0 | - | - |
| - | 27570..27633 | - | 64 | - | - | Antitoxin |
| BWI82_RS27065 | 27682..27840 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| BWI82_RS27830 | 28141..28437 | - | 297 | Protein_41 | hypothetical protein | - |
| BWI82_RS27835 | 28507..28710 | + | 204 | Protein_42 | single-stranded DNA-binding protein | - |
| BWI82_RS27080 | 28733..29056 | + | 324 | WP_000533253.1 | hypothetical protein | - |
| BWI82_RS27085 | 29115..29357 | + | 243 | WP_000540591.1 | hypothetical protein | - |
| BWI82_RS27105 | 30280..30576 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| BWI82_RS27110 | 30687..31508 | + | 822 | WP_021553189.1 | DUF945 domain-containing protein | - |
| BWI82_RS27115 | 31804..32313 | - | 510 | WP_089576520.1 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | oqxB / oqxA | - | 1..71430 | 71430 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T71937 WP_001312861.1 NZ_CP019244:27682-27840 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T71937 NZ_CP019244:27682-27840 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT71937 NZ_CP019244:c27633-27570 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|