Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2208276..2208473 | Replicon | chromosome |
Accession | NZ_CP019117 | ||
Organism | Staphylococcus aureus strain SJTUF_J27 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | BRL61_RS11450 | Protein ID | WP_073392962.1 |
Coordinates | 2208369..2208473 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2208276..2208314 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BRL61_RS11430 | 2204451..2205116 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
BRL61_RS11435 | 2205268..2205588 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
BRL61_RS11440 | 2205590..2206570 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
BRL61_RS11445 | 2206836..2207927 | + | 1092 | WP_053865863.1 | hypothetical protein | - |
- | 2208276..2208314 | + | 39 | - | - | Antitoxin |
BRL61_RS11450 | 2208369..2208473 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
BRL61_RS11460 | 2209153..2209311 | + | 159 | WP_001792784.1 | hypothetical protein | - |
BRL61_RS11470 | 2209970..2210827 | - | 858 | WP_000370937.1 | Cof-type HAD-IIB family hydrolase | - |
BRL61_RS11475 | 2210895..2211677 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T71760 WP_073392962.1 NZ_CP019117:c2208473-2208369 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T71760 NZ_CP019117:c2208473-2208369 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT71760 NZ_CP019117:2208276-2208314 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|