Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1875740..1875920 | Replicon | chromosome |
Accession | NZ_CP019117 | ||
Organism | Staphylococcus aureus strain SJTUF_J27 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | BRL61_RS14785 | Protein ID | WP_001801861.1 |
Coordinates | 1875740..1875835 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1875863..1875920 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BRL61_RS09350 | 1870884..1871510 | + | 627 | WP_000669038.1 | hypothetical protein | - |
BRL61_RS09355 | 1871551..1871895 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
BRL61_RS09360 | 1871993..1872565 | + | 573 | WP_000414222.1 | hypothetical protein | - |
BRL61_RS09365 | 1872714..1874081 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
BRL61_RS09370 | 1874081..1874650 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
BRL61_RS09375 | 1874843..1875289 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
BRL61_RS14785 | 1875740..1875835 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1875863..1875920 | - | 58 | - | - | Antitoxin |
BRL61_RS09385 | 1875958..1876059 | + | 102 | WP_001791232.1 | hypothetical protein | - |
BRL61_RS09390 | 1876234..1876677 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
BRL61_RS09395 | 1876677..1877120 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
BRL61_RS09400 | 1877120..1877562 | - | 443 | Protein_1763 | DUF1433 domain-containing protein | - |
BRL61_RS09405 | 1878087..1880507 | + | 2421 | WP_000182551.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T71754 WP_001801861.1 NZ_CP019117:1875740-1875835 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T71754 NZ_CP019117:1875740-1875835 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT71754 NZ_CP019117:c1875920-1875863 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|