Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 150361..150631 | Replicon | plasmid p1540-4 |
Accession | NZ_CP019055 | ||
Organism | Escherichia coli strain CRE1540 |
Toxin (Protein)
Gene name | hok | Uniprot ID | B1VC78 |
Locus tag | BVL39_RS28565 | Protein ID | WP_001302184.1 |
Coordinates | 150473..150631 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 150361..150424 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BVL39_RS28540 | 146455..146889 | + | 435 | WP_000845962.1 | conjugation system SOS inhibitor PsiB | - |
BVL39_RS28545 | 146886..147089 | + | 204 | Protein_148 | plasmid SOS inhibition protein A | - |
BVL39_RS28550 | 147171..147917 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
BVL39_RS28555 | 147932..149473 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
BVL39_RS28560 | 149666..150236 | + | 571 | Protein_151 | plasmid SOS inhibition protein A | - |
- | 150205..150429 | + | 225 | NuclAT_0 | - | - |
- | 150205..150429 | + | 225 | NuclAT_0 | - | - |
- | 150205..150429 | + | 225 | NuclAT_0 | - | - |
- | 150205..150429 | + | 225 | NuclAT_0 | - | - |
- | 150361..150424 | - | 64 | - | - | Antitoxin |
BVL39_RS28565 | 150473..150631 | + | 159 | WP_001302184.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BVL39_RS28575 | 151257..151553 | + | 297 | WP_001272245.1 | hypothetical protein | - |
BVL39_RS28580 | 151664..152485 | + | 822 | WP_001234487.1 | DUF945 domain-containing protein | - |
BVL39_RS28585 | 152782..153384 | - | 603 | WP_077250849.1 | transglycosylase SLT domain-containing protein | - |
BVL39_RS28590 | 153705..154088 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
BVL39_RS28595 | 154275..154964 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
BVL39_RS28600 | 155063..155458 | + | 396 | WP_001309237.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..184166 | 184166 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6108.35 Da Isoelectric Point: 9.1977
>T71644 WP_001302184.1 NZ_CP019055:150473-150631 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 159 bp
>T71644 NZ_CP019055:150473-150631 [Escherichia coli]
ATGAAACTACCACGCAGCTCTCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGCAGCTCTCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT71644 NZ_CP019055:c150424-150361 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|