Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 106876..107145 | Replicon | plasmid pECAZ162_KPC |
Accession | NZ_CP019014 | ||
Organism | Escherichia coli strain Ecol_AZ162 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | BE965_RS01375 | Protein ID | WP_001312861.1 |
Coordinates | 106987..107145 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 106876..106941 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BE965_RS01350 | 102669..103196 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
BE965_RS01355 | 103252..103485 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
BE965_RS01360 | 103544..105502 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
BE965_RS01365 | 105557..105991 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
BE965_RS01370 | 105988..106707 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
BE965_RS28630 | 106719..106907 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 106719..106943 | + | 225 | NuclAT_0 | - | - |
- | 106719..106943 | + | 225 | NuclAT_0 | - | - |
- | 106719..106943 | + | 225 | NuclAT_0 | - | - |
- | 106719..106943 | + | 225 | NuclAT_0 | - | - |
- | 106876..106941 | + | 66 | - | - | Antitoxin |
BE965_RS01375 | 106987..107145 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BE965_RS01395 | 108064..108351 | + | 288 | WP_000107537.1 | hypothetical protein | - |
BE965_RS01400 | 108472..109293 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
BE965_RS01405 | 109590..110237 | - | 648 | WP_000614282.1 | transglycosylase SLT domain-containing protein | - |
BE965_RS01410 | 110523..110906 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
BE965_RS01415 | 111100..111786 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
BE965_RS01420 | 111880..112107 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(3'')-Ib / aph(6)-Id / blaKPC-3 / tet(A) / sul1 / qacE / aadA5 / sul2 | - | 1..142829 | 142829 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T71464 WP_001312861.1 NZ_CP019014:106987-107145 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T71464 NZ_CP019014:106987-107145 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT71464 NZ_CP019014:106876-106941 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|