Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 65786..66028 | Replicon | plasmid pECAZ161_3 |
| Accession | NZ_CP019009 | ||
| Organism | Escherichia coli strain Ecol_AZ161 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BE946_RS00430 | Protein ID | WP_001312861.1 |
| Coordinates | 65786..65944 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 65988..66028 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BE946_RS00380 | 60898..61125 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| BE946_RS00385 | 61213..61890 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| BE946_RS00390 | 62024..62407 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| BE946_RS00395 | 62738..63340 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| BE946_RS00400 | 63637..64458 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| BE946_RS00405 | 64577..64864 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| BE946_RS27800 | 64889..65095 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| BE946_RS00430 | 65786..65944 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 65988..66028 | - | 41 | NuclAT_1 | - | Antitoxin |
| - | 65988..66028 | - | 41 | NuclAT_1 | - | Antitoxin |
| - | 65988..66028 | - | 41 | NuclAT_1 | - | Antitoxin |
| - | 65988..66028 | - | 41 | NuclAT_1 | - | Antitoxin |
| - | 67472..67658 | - | 187 | NuclAT_0 | - | - |
| - | 67472..67658 | - | 187 | NuclAT_0 | - | - |
| - | 67472..67658 | - | 187 | NuclAT_0 | - | - |
| - | 67472..67658 | - | 187 | NuclAT_0 | - | - |
| BE946_RS00445 | 67670..68389 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| BE946_RS00450 | 68386..68820 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| BE946_RS00455 | 68875..70833 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3'')-Ib / aph(6)-Id / tet(A) / aac(3)-IId / blaTEM-1B / dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 | - | 1..130905 | 130905 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T71427 WP_001312861.1 NZ_CP019009:c65944-65786 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T71427 NZ_CP019009:c65944-65786 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT71427 NZ_CP019009:c66028-65988 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|