Detailed information of TA system TA071423

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 21409..21648
• Replicon: plasmid pECAZ161_3
• Accession: NZ_CP019009
• Organism: Escherichia coli strain Ecol_AZ161

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: BE946_RS00160
• Protein ID: WP_023144756.1
• Coordinates: 21409..21543 (-)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	21588..21648 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BE946_RS00125	17420..17821	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
BE946_RS27565	17754..18011	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
BE946_RS00130	18104..18757	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
BE946_RS00140	19697..20554	-	858	WP_001617855.1	incFII family plasmid replication initiator RepA	-
BE946_RS00145	20547..20621	-	75	WP_031943482.1	RepA leader peptide Tap	-
BE946_RS27795	20618..20752	-	135	Protein_27	protein CopA/IncA	-
BE946_RS00155	20858..21112	-	255	WP_000083850.1	replication regulatory protein RepA	-
BE946_RS00160	21409..21543	-	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	21588..21648	+	61	NuclAT_2	-	Antitoxin
-	21588..21648	+	61	NuclAT_2	-	Antitoxin
-	21588..21648	+	61	NuclAT_2	-	Antitoxin
-	21588..21648	+	61	NuclAT_2	-	Antitoxin
BE946_RS00165	21615..21901	-	287	Protein_30	DUF2726 domain-containing protein	-
BE946_RS00170	21979..23592	-	1614	WP_000080195.1	IS66-like element ISEc23 family transposase	-
BE946_RS00175	23623..23973	-	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
BE946_RS00180	23970..24395	-	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
BE946_RS00190	24954..25166	-	213	WP_013023861.1	hypothetical protein	-
BE946_RS00195	25257..25682	+	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
BE946_RS00200	25679..26029	+	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aph(3'')-Ib / aph(6)-Id / tet(A) / aac(3)-IId / blaTEM-1B / dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2	-	1..130905	130905

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T71423 WP_023144756.1 NZ_CP019009:c21543-21409 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

>T71423 NZ_CP019009:c21543-21409 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA

Antitoxin

Nucleotide

• Length: 61 bp

>AT71423 NZ_CP019009:21588-21648 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin