Detailed information of TA system TA071360

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 17253..17486
• Replicon: plasmid pECAZ155_KPC
• Accession: NZ_CP019001
• Organism: Escherichia coli strain Ecol_AZ155

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: BE948_RS00150
• Protein ID: WP_001312861.1
• Coordinates: 17328..17486 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	17253..17284 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BE948_RS00100	12484..12690	+	207	WP_001774176.1	hypothetical protein	-
BE948_RS27725	13100..13306	+	207	WP_000275856.1	hypothetical protein	-
BE948_RS00120	13332..13871	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
BE948_RS00125	13939..14172	+	234	WP_000005990.1	DUF905 family protein	-
BE948_RS00130	14200..14397	+	198	Protein_20	hypothetical protein	-
BE948_RS00135	14452..14886	+	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
BE948_RS00140	14883..15602	+	720	WP_001276238.1	plasmid SOS inhibition protein A	-
BE948_RS27305	15614..15802	-	189	WP_001299721.1	hypothetical protein	-
-	15614..15811	+	198	NuclAT_0	-	-
-	15614..15811	+	198	NuclAT_0	-	-
-	15614..15811	+	198	NuclAT_0	-	-
-	15614..15811	+	198	NuclAT_0	-	-
BE948_RS00145	15859..17228	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
-	17253..17284	+	32	NuclAT_1	-	Antitoxin
-	17253..17284	+	32	NuclAT_1	-	Antitoxin
-	17253..17284	+	32	NuclAT_1	-	Antitoxin
-	17253..17284	+	32	NuclAT_1	-	Antitoxin
BE948_RS00150	17328..17486	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
BE948_RS00170	18407..18694	+	288	WP_000107535.1	hypothetical protein	-
BE948_RS00175	18812..19633	+	822	WP_001234426.1	DUF945 domain-containing protein	-
BE948_RS00180	19930..20532	-	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
BE948_RS00185	20853..21236	+	384	WP_001151524.1	relaxosome protein TraM	-
BE948_RS00190	21423..22112	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaKPC-2 / sul1 / qacE / aac(6')-Il / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaCMY-2 / tet(B) / sitABCD	iucA / iucB / iucC / iucD / iutA	1..272202	272202

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T71360 WP_001312861.1 NZ_CP019001:17328-17486 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

>T71360 NZ_CP019001:17328-17486 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 32 bp

>AT71360 NZ_CP019001:17253-17284 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin