Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 91966..92230 | Replicon | plasmid pECAZ147_2 |
Accession | NZ_CP018993 | ||
Organism | Escherichia coli strain Ecol_AZ147 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | BE962_RS01275 | Protein ID | WP_001331364.1 |
Coordinates | 91966..92118 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 92173..92230 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BE962_RS01255 | 87300..89468 | + | 2169 | WP_078232638.1 | DotA/TraY family protein | - |
BE962_RS01260 | 89533..90195 | + | 663 | WP_000644792.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
BE962_RS01265 | 90267..90476 | - | 210 | WP_000062602.1 | HEAT repeat domain-containing protein | - |
BE962_RS27440 | 90808..90984 | + | 177 | WP_001054900.1 | hypothetical protein | - |
BE962_RS01270 | 91643..91894 | + | 252 | WP_001291964.1 | hypothetical protein | - |
BE962_RS01275 | 91966..92118 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
- | 92173..92230 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 92173..92230 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 92173..92230 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 92173..92230 | + | 58 | NuclAT_0 | - | Antitoxin |
BE962_RS01280 | 92391..93377 | + | 987 | WP_001257838.1 | hypothetical protein | - |
BE962_RS01285 | 93595..94803 | + | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
BE962_RS01290 | 94822..95892 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / aac(3)-IVa / aph(4)-Ia / tet(M) / floR | - | 1..116562 | 116562 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T71299 WP_001331364.1 NZ_CP018993:c92118-91966 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T71299 NZ_CP018993:c92118-91966 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT71299 NZ_CP018993:92173-92230 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|