Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53269..53539 | Replicon | plasmid pECAZ146_1 |
| Accession | NZ_CP018990 | ||
| Organism | Escherichia coli strain Ecol_AZ146 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BE932_RS01300 | Protein ID | WP_001312861.1 |
| Coordinates | 53381..53539 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 53269..53332 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BE932_RS01270 | 48822..50723 | + | 1902 | WP_000936285.1 | group II intron reverse transcriptase/maturase | - |
| BE932_RS01275 | 50873..51370 | + | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
| BE932_RS01280 | 51438..51671 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| BE932_RS01285 | 51699..51896 | + | 198 | Protein_61 | hypothetical protein | - |
| BE932_RS01290 | 51951..52385 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| BE932_RS01295 | 52382..53101 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| BE932_RS30595 | 53113..53301 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 53113..53337 | + | 225 | NuclAT_0 | - | - |
| - | 53113..53337 | + | 225 | NuclAT_0 | - | - |
| - | 53113..53337 | + | 225 | NuclAT_0 | - | - |
| - | 53113..53337 | + | 225 | NuclAT_0 | - | - |
| - | 53269..53332 | - | 64 | - | - | Antitoxin |
| BE932_RS01300 | 53381..53539 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| BE932_RS01320 | 54460..54747 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| BE932_RS01325 | 54865..55686 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| BE932_RS01330 | 55983..56585 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| BE932_RS01335 | 56906..57289 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| BE932_RS01340 | 57476..58165 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / mph(A) / sul1 / qacE / aadA5 | iucD / iutA | 1..150994 | 150994 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T71257 WP_001312861.1 NZ_CP018990:53381-53539 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T71257 NZ_CP018990:53381-53539 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT71257 NZ_CP018990:c53332-53269 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|