Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 61682..61921 | Replicon | plasmid pEC867_1 |
Accession | NZ_CP018982 | ||
Organism | Escherichia coli strain Ecol_867 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A762TWR7 |
Locus tag | BE928_RS00485 | Protein ID | WP_023144756.1 |
Coordinates | 61787..61921 (+) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 61682..61742 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BE928_RS00450 | 57473..58033 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
BE928_RS00455 | 58164..58376 | + | 213 | WP_013023861.1 | hypothetical protein | - |
BE928_RS00465 | 58935..59360 | + | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
BE928_RS00470 | 59357..59707 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
BE928_RS00475 | 59738..61351 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
BE928_RS00480 | 61429..61715 | + | 287 | Protein_64 | DUF2726 domain-containing protein | - |
- | 61682..61742 | - | 61 | NuclAT_2 | - | Antitoxin |
- | 61682..61742 | - | 61 | NuclAT_2 | - | Antitoxin |
- | 61682..61742 | - | 61 | NuclAT_2 | - | Antitoxin |
- | 61682..61742 | - | 61 | NuclAT_2 | - | Antitoxin |
BE928_RS00485 | 61787..61921 | + | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BE928_RS00490 | 62218..62472 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
BE928_RS27065 | 62578..62712 | + | 135 | Protein_67 | protein CopA/IncA | - |
BE928_RS00500 | 62709..62783 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
BE928_RS00505 | 62776..63633 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
BE928_RS00515 | 64573..65226 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
BE928_RS26845 | 65319..65576 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
BE928_RS00520 | 65509..65910 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | - | 1..100168 | 100168 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T71222 WP_023144756.1 NZ_CP018982:61787-61921 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T71222 NZ_CP018982:61787-61921 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT71222 NZ_CP018982:c61742-61682 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|