Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4347109..4347330 Replicon chromosome
Accession NZ_CP018979
Organism Escherichia coli strain Ecol_656

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag BE941_RS23455 Protein ID WP_001531632.1
Coordinates 4347109..4347216 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4347264..4347330 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BE941_RS23430 4342953..4344035 + 1083 WP_000804726.1 peptide chain release factor 1 -
BE941_RS23435 4344035..4344868 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
BE941_RS23440 4344865..4345257 + 393 WP_000200375.1 invasion regulator SirB2 -
BE941_RS23445 4345261..4346070 + 810 WP_001257044.1 invasion regulator SirB1 -
BE941_RS23450 4346106..4346960 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
BE941_RS23455 4347109..4347216 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4347264..4347330 + 67 NuclAT_10 - Antitoxin
- 4347264..4347330 + 67 NuclAT_10 - Antitoxin
- 4347264..4347330 + 67 NuclAT_10 - Antitoxin
- 4347264..4347330 + 67 NuclAT_10 - Antitoxin
- 4347264..4347330 + 67 NuclAT_5 - Antitoxin
- 4347264..4347330 + 67 NuclAT_5 - Antitoxin
- 4347264..4347330 + 67 NuclAT_5 - Antitoxin
- 4347264..4347330 + 67 NuclAT_5 - Antitoxin
- 4347264..4347330 + 67 NuclAT_6 - Antitoxin
- 4347264..4347330 + 67 NuclAT_6 - Antitoxin
- 4347264..4347330 + 67 NuclAT_6 - Antitoxin
- 4347264..4347330 + 67 NuclAT_6 - Antitoxin
- 4347264..4347330 + 67 NuclAT_7 - Antitoxin
- 4347264..4347330 + 67 NuclAT_7 - Antitoxin
- 4347264..4347330 + 67 NuclAT_7 - Antitoxin
- 4347264..4347330 + 67 NuclAT_7 - Antitoxin
- 4347264..4347330 + 67 NuclAT_8 - Antitoxin
- 4347264..4347330 + 67 NuclAT_8 - Antitoxin
- 4347264..4347330 + 67 NuclAT_8 - Antitoxin
- 4347264..4347330 + 67 NuclAT_8 - Antitoxin
- 4347264..4347330 + 67 NuclAT_9 - Antitoxin
- 4347264..4347330 + 67 NuclAT_9 - Antitoxin
- 4347264..4347330 + 67 NuclAT_9 - Antitoxin
- 4347264..4347330 + 67 NuclAT_9 - Antitoxin
- 4347266..4347329 + 64 NuclAT_12 - -
- 4347266..4347329 + 64 NuclAT_12 - -
- 4347266..4347329 + 64 NuclAT_12 - -
- 4347266..4347329 + 64 NuclAT_12 - -
- 4347266..4347329 + 64 NuclAT_13 - -
- 4347266..4347329 + 64 NuclAT_13 - -
- 4347266..4347329 + 64 NuclAT_13 - -
- 4347266..4347329 + 64 NuclAT_13 - -
- 4347266..4347329 + 64 NuclAT_14 - -
- 4347266..4347329 + 64 NuclAT_14 - -
- 4347266..4347329 + 64 NuclAT_14 - -
- 4347266..4347329 + 64 NuclAT_14 - -
- 4347266..4347329 + 64 NuclAT_15 - -
- 4347266..4347329 + 64 NuclAT_15 - -
- 4347266..4347329 + 64 NuclAT_15 - -
- 4347266..4347329 + 64 NuclAT_15 - -
- 4347266..4347329 + 64 NuclAT_16 - -
- 4347266..4347329 + 64 NuclAT_16 - -
- 4347266..4347329 + 64 NuclAT_16 - -
- 4347266..4347329 + 64 NuclAT_16 - -
- 4347266..4347329 + 64 NuclAT_17 - -
- 4347266..4347329 + 64 NuclAT_17 - -
- 4347266..4347329 + 64 NuclAT_17 - -
- 4347266..4347329 + 64 NuclAT_17 - -
- 4347266..4347331 + 66 NuclAT_18 - -
- 4347266..4347331 + 66 NuclAT_18 - -
- 4347266..4347331 + 66 NuclAT_18 - -
- 4347266..4347331 + 66 NuclAT_18 - -
- 4347266..4347331 + 66 NuclAT_19 - -
- 4347266..4347331 + 66 NuclAT_19 - -
- 4347266..4347331 + 66 NuclAT_19 - -
- 4347266..4347331 + 66 NuclAT_19 - -
- 4347266..4347331 + 66 NuclAT_20 - -
- 4347266..4347331 + 66 NuclAT_20 - -
- 4347266..4347331 + 66 NuclAT_20 - -
- 4347266..4347331 + 66 NuclAT_20 - -
- 4347266..4347331 + 66 NuclAT_21 - -
- 4347266..4347331 + 66 NuclAT_21 - -
- 4347266..4347331 + 66 NuclAT_21 - -
- 4347266..4347331 + 66 NuclAT_21 - -
- 4347266..4347331 + 66 NuclAT_22 - -
- 4347266..4347331 + 66 NuclAT_22 - -
- 4347266..4347331 + 66 NuclAT_22 - -
- 4347266..4347331 + 66 NuclAT_22 - -
- 4347266..4347331 + 66 NuclAT_23 - -
- 4347266..4347331 + 66 NuclAT_23 - -
- 4347266..4347331 + 66 NuclAT_23 - -
- 4347266..4347331 + 66 NuclAT_23 - -
BE941_RS23465 4347621..4348721 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
BE941_RS23470 4348991..4349230 + 240 WP_000120702.1 putative cation transport regulator ChaB -
BE941_RS23475 4349379..4350074 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
BE941_RS23480 4350118..4350471 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
BE941_RS23485 4350656..4352050 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T71203 WP_001531632.1 NZ_CP018979:c4347216-4347109 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T71203 NZ_CP018979:c4347216-4347109 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT71203 NZ_CP018979:4347264-4347330 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9


Antitoxin

Download structure file

References