Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 51629..51899 | Replicon | plasmid pEC656_1 |
Accession | NZ_CP018978 | ||
Organism | Escherichia coli strain Ecol_656 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | BE941_RS00750 | Protein ID | WP_001312861.1 |
Coordinates | 51741..51899 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 51629..51692 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BE941_RS00725 | 47423..47950 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
BE941_RS00730 | 48006..48239 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
BE941_RS00735 | 48298..50256 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
BE941_RS00740 | 50311..50745 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
BE941_RS00745 | 50742..51461 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
BE941_RS28425 | 51473..51661 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 51473..51697 | + | 225 | NuclAT_0 | - | - |
- | 51473..51697 | + | 225 | NuclAT_0 | - | - |
- | 51473..51697 | + | 225 | NuclAT_0 | - | - |
- | 51473..51697 | + | 225 | NuclAT_0 | - | - |
- | 51629..51692 | - | 64 | - | - | Antitoxin |
BE941_RS00750 | 51741..51899 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BE941_RS00770 | 52818..53105 | + | 288 | WP_000107537.1 | hypothetical protein | - |
BE941_RS00775 | 53226..54047 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
BE941_RS00780 | 54344..54991 | - | 648 | WP_000614282.1 | transglycosylase SLT domain-containing protein | - |
BE941_RS00785 | 55277..55660 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
BE941_RS00790 | 55854..56540 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
BE941_RS00795 | 56634..56861 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / tet(A) | - | 1..117844 | 117844 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T71181 WP_001312861.1 NZ_CP018978:51741-51899 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T71181 NZ_CP018978:51741-51899 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT71181 NZ_CP018978:c51692-51629 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|