Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 20521..20763 | Replicon | plasmid pEC542_1 |
Accession | NZ_CP018969 | ||
Organism | Escherichia coli strain Ecol_542 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | BE966_RS00505 | Protein ID | WP_001312861.1 |
Coordinates | 20521..20679 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 20723..20763 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BE966_RS00455 | 15633..15860 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
BE966_RS00460 | 15948..16625 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
BE966_RS00465 | 16759..17142 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
BE966_RS00470 | 17473..18075 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
BE966_RS00475 | 18372..19193 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
BE966_RS00480 | 19312..19599 | - | 288 | WP_000107535.1 | hypothetical protein | - |
BE966_RS29055 | 19624..19830 | - | 207 | WP_000275859.1 | hypothetical protein | - |
BE966_RS29060 | 19743..20078 | - | 336 | WP_013023876.1 | hypothetical protein | - |
BE966_RS00505 | 20521..20679 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 20723..20763 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 20723..20763 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 20723..20763 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 20723..20763 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 22207..22393 | - | 187 | NuclAT_0 | - | - |
- | 22207..22393 | - | 187 | NuclAT_0 | - | - |
- | 22207..22393 | - | 187 | NuclAT_0 | - | - |
- | 22207..22393 | - | 187 | NuclAT_0 | - | - |
BE966_RS00520 | 22405..23124 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
BE966_RS00525 | 23121..23555 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
BE966_RS00530 | 23610..25568 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-27 | - | 1..82364 | 82364 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T71106 WP_001312861.1 NZ_CP018969:c20679-20521 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T71106 NZ_CP018969:c20679-20521 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT71106 NZ_CP018969:c20763-20723 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|