Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 116000..116239 | Replicon | plasmid pEC276_1 |
Accession | NZ_CP018952 | ||
Organism | Escherichia coli strain Ecol_276 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A762TWR7 |
Locus tag | BE964_RS01465 | Protein ID | WP_023144756.1 |
Coordinates | 116105..116239 (+) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 116000..116060 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BE964_RS01430 | 111791..112351 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
BE964_RS01435 | 112482..112694 | + | 213 | WP_013023861.1 | hypothetical protein | - |
BE964_RS01445 | 113253..113678 | + | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
BE964_RS01450 | 113675..114025 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
BE964_RS01455 | 114056..115669 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
BE964_RS27360 | 115747..116033 | + | 287 | Protein_130 | DUF2726 domain-containing protein | - |
- | 116000..116060 | - | 61 | NuclAT_2 | - | Antitoxin |
- | 116000..116060 | - | 61 | NuclAT_2 | - | Antitoxin |
- | 116000..116060 | - | 61 | NuclAT_2 | - | Antitoxin |
- | 116000..116060 | - | 61 | NuclAT_2 | - | Antitoxin |
BE964_RS01465 | 116105..116239 | + | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BE964_RS01470 | 116536..116790 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
BE964_RS27505 | 116896..117030 | + | 135 | Protein_133 | protein CopA/IncA | - |
BE964_RS01480 | 117027..117101 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
BE964_RS01485 | 117094..117951 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
BE964_RS01495 | 118891..119544 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
BE964_RS27000 | 119637..119894 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
BE964_RS01500 | 119827..120228 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | senB | 1..132345 | 132345 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T71004 WP_023144756.1 NZ_CP018952:116105-116239 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T71004 NZ_CP018952:116105-116239 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT71004 NZ_CP018952:c116060-116000 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|