Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 74160..74402 | Replicon | plasmid pEC276_1 |
| Accession | NZ_CP018952 | ||
| Organism | Escherichia coli strain Ecol_276 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BE964_RS01210 | Protein ID | WP_001312861.1 |
| Coordinates | 74244..74402 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 74160..74200 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BE964_RS01185 | 69355..71313 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| BE964_RS01190 | 71368..71802 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| BE964_RS01195 | 71799..72518 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| - | 72530..72716 | + | 187 | NuclAT_0 | - | - |
| - | 72530..72716 | + | 187 | NuclAT_0 | - | - |
| - | 72530..72716 | + | 187 | NuclAT_0 | - | - |
| - | 72530..72716 | + | 187 | NuclAT_0 | - | - |
| BE964_RS01205 | 72764..74133 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 74160..74200 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 74160..74200 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 74160..74200 | + | 41 | NuclAT_1 | - | Antitoxin |
| - | 74160..74200 | + | 41 | NuclAT_1 | - | Antitoxin |
| BE964_RS01210 | 74244..74402 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| BE964_RS27500 | 74845..75180 | + | 336 | WP_013023876.1 | hypothetical protein | - |
| BE964_RS27355 | 75093..75299 | + | 207 | WP_000275859.1 | hypothetical protein | - |
| BE964_RS01235 | 75324..75611 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| BE964_RS01240 | 75730..76551 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| BE964_RS01245 | 76848..77450 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| BE964_RS01250 | 77781..78164 | + | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| BE964_RS01255 | 78298..78975 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| BE964_RS01260 | 79063..79290 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB | 1..132345 | 132345 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T71000 WP_001312861.1 NZ_CP018952:74244-74402 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T71000 NZ_CP018952:74244-74402 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT71000 NZ_CP018952:74160-74200 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|