Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 1547625..1547773 | Replicon | chromosome |
Accession | NZ_CP018842 | ||
Organism | Staphylococcus epidermidis strain 14.1.R1 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | BUM85_RS07725 | Protein ID | WP_011276848.1 |
Coordinates | 1547678..1547773 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1547625..1547660 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BUM85_RS07685 | 1543083..1543509 | - | 427 | Protein_1479 | hypothetical protein | - |
BUM85_RS07690 | 1543553..1543813 | - | 261 | Protein_1480 | IS200/IS605 family transposase | - |
BUM85_RS07695 | 1543886..1544257 | - | 372 | Protein_1481 | recombinase family protein | - |
BUM85_RS07700 | 1544520..1545170 | - | 651 | WP_002476158.1 | NAD(P)-dependent oxidoreductase | - |
BUM85_RS07705 | 1545219..1545527 | - | 309 | WP_002476154.1 | DoxX family protein | - |
BUM85_RS07710 | 1545543..1546202 | - | 660 | Protein_1484 | DsbA family oxidoreductase | - |
BUM85_RS07715 | 1546323..1546751 | - | 429 | WP_002476150.1 | Rrf2 family transcriptional regulator | - |
BUM85_RS07720 | 1546865..1547296 | - | 432 | Protein_1486 | thymidylate synthase | - |
- | 1547625..1547660 | - | 36 | - | - | Antitoxin |
BUM85_RS07725 | 1547678..1547773 | - | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
BUM85_RS07730 | 1548693..1548758 | + | 66 | WP_109043807.1 | YSIRK-type signal peptide-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1543535..1543813 | 278 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T70688 WP_011276848.1 NZ_CP018842:c1547773-1547678 [Staphylococcus epidermidis]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T70688 NZ_CP018842:c1547773-1547678 [Staphylococcus epidermidis]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT70688 NZ_CP018842:c1547660-1547625 [Staphylococcus epidermidis]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|