Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 242..140717 Replicon plasmid unitig_1
Accession NZ_CP018817
Organism Klebsiella pneumoniae strain AR_0049

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag AM428_RS28655 Protein ID WP_000270043.1
Coordinates 140717..242 (+) Length -46824.666666667 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag AM428_RS28660 Protein ID WP_000124640.1
Coordinates 247..549 (+) Length 101 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM428_RS28660 247..549 + 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
AM428_RS28665 576..869 - 294 WP_001239998.1 hypothetical protein -
AM428_RS28670 958..1230 - 273 WP_001043046.1 HU family DNA-binding protein -
AM428_RS28675 1288..1815 - 528 WP_004201083.1 thermonuclease family protein -
AM428_RS33480 1818..2123 - 306 WP_171820680.1 hypothetical protein -
AM428_RS28685 2035..2892 - 858 WP_001167036.1 hypothetical protein -
AM428_RS28690 2879..3109 - 231 WP_000972665.1 hypothetical protein -
AM428_RS28695 3109..3627 - 519 WP_000210757.1 nitrite reductase -
AM428_RS28700 3624..4070 - 447 WP_000919343.1 hypothetical protein -
AM428_RS28705 4070..4429 - 360 WP_000422769.1 hypothetical protein -
AM428_RS28710 4487..4915 - 429 WP_000591076.1 hypothetical protein -
AM428_RS28715 4949..5809 - 861 WP_004201087.1 DsbA family protein -
AM428_RS28720 5825..6784 - 960 WP_000829617.1 S49 family peptidase -
AM428_RS28725 6784..7638 - 855 WP_000539391.1 hypothetical protein -
AM428_RS28730 7643..7936 - 294 WP_001370730.1 hypothetical protein -
AM428_RS28735 7947..8420 - 474 WP_000057876.1 hypothetical protein -
AM428_RS28740 8517..9038 - 522 WP_000648873.1 hypothetical protein -
AM428_RS28745 9041..9562 - 522 WP_000393783.1 hypothetical protein -
AM428_RS28750 9567..10175 - 609 WP_000849069.1 hypothetical protein -
AM428_RS28760 10443..11558 + 1116 WP_000946104.1 phosphoadenosine phosphosulfate reductase family protein -
AM428_RS28765 11576..12010 + 435 WP_004201092.1 hypothetical protein -
AM428_RS28785 13047..14147 - 1101 WP_001348532.1 hypothetical protein -
AM428_RS28790 14132..14419 - 288 WP_000127321.1 hypothetical protein -
AM428_RS28795 14424..14963 - 540 WP_001447712.1 hypothetical protein -
AM428_RS28800 15462..16445 + 984 WP_000077457.1 ParM/StbA family protein -
AM428_RS28805 16462..16755 + 294 WP_000919078.1 hypothetical protein -
AM428_RS28810 16757..17176 + 420 WP_000651490.1 H-NS histone family protein -
AM428_RS28815 17236..17787 - 552 WP_001020646.1 hypothetical protein -
AM428_RS28820 17784..18392 - 609 WP_000891157.1 hypothetical protein -
AM428_RS28825 18403..18936 - 534 WP_000790610.1 transglycosylase SLT domain-containing protein -
AM428_RS28830 18936..19208 - 273 WP_000356489.1 helix-turn-helix domain-containing protein -
AM428_RS28835 19923..20285 + 363 WP_000683483.1 hypothetical protein -
AM428_RS28840 20323..23937 - 3615 WP_000534551.1 conjugal transfer protein TraG N-terminal domain-containing protein -
AM428_RS28845 23950..25383 - 1434 WP_000256129.1 conjugal transfer protein TraH -
AM428_RS28850 25385..26425 - 1041 WP_001326396.1 conjugal transfer protein TraF -
AM428_RS28855 26536..28047 - 1512 WP_000811656.1 ATP-dependent helicase -
AM428_RS28865 28334..29374 - 1041 WP_000101568.1 DNA-binding protein -
AM428_RS28870 29457..32474 - 3018 WP_004199413.1 Tn3-like element IS3000 family transposase -
AM428_RS28875 32768..33643 - 876 WP_001097010.1 DNA replication terminus site-binding protein -
AM428_RS28885 33960..34451 - 492 WP_000139717.1 hypothetical protein -
AM428_RS28890 34448..35317 - 870 WP_004201184.1 3'-5' exonuclease -
AM428_RS28895 35322..36332 - 1011 WP_000543934.1 tyrosine-type recombinase/integrase -
AM428_RS28900 36335..36871 - 537 WP_000949433.1 hypothetical protein -
AM428_RS28910 37170..37451 - 282 WP_000575657.1 hypothetical protein -
AM428_RS28915 37721..38323 + 603 WP_000278322.1 hypothetical protein -
AM428_RS28920 38339..38791 - 453 WP_000791469.1 hypothetical protein -
AM428_RS28925 38962..39402 - 441 WP_001326394.1 hypothetical protein -
AM428_RS28930 39374..41872 - 2499 Protein_48 RHS repeat protein -
AM428_RS28935 41844..42446 - 603 Protein_49 transposase zinc-binding domain-containing protein -
AM428_RS28940 42635..44275 - 1641 WP_004201176.1 chaperonin GroEL -
AM428_RS28945 44331..44621 - 291 WP_004201172.1 co-chaperone GroES -
AM428_RS28950 44815..45144 + 330 WP_004201171.1 divalent-cation tolerance protein CutA -
AM428_RS28955 45149..46180 + 1032 WP_004201169.1 protein-disulfide reductase DsbD N-terminal domain-containing protein -
AM428_RS28960 46191..46829 - 639 WP_004201168.1 phosphoribosylanthranilate isomerase -
AM428_RS28965 46834..47199 - 366 WP_004201167.1 bleomycin binding protein Ble-MBL -
AM428_RS28970 47203..48015 - 813 WP_004201164.1 subclass B1 metallo-beta-lactamase NDM-1 -
AM428_RS28975 48254..48951 - 698 Protein_57 IS1 family transposase -
AM428_RS28990 49261..50106 + 846 WP_000855769.1 RmtC family 16S rRNA (guanine(1405)-N(7))-methyltransferase -
AM428_RS28995 50204..50857 - 654 WP_004201046.1 endonuclease III -
AM428_RS29000 51200..51751 - 552 Protein_60 DNA cytosine methyltransferase -
AM428_RS29005 52084..52254 + 171 WP_016479969.1 hypothetical protein -
AM428_RS29010 52368..52667 + 300 WP_001183923.1 DUF2293 domain-containing protein -
AM428_RS29015 52751..52993 - 243 WP_000376617.1 hypothetical protein -
AM428_RS29020 53120..53959 - 840 WP_000259031.1 sulfonamide-resistant dihydropteroate synthase Sul1 -
AM428_RS29025 53953..54300 - 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
AM428_RS29030 54469..55023 - 555 WP_032488579.1 aminoglycoside N-acetyltransferase AAC(6')-Ib3 -
AM428_RS29040 55254..56267 + 1014 WP_000845039.1 class 1 integron integrase IntI1 -
AM428_RS29050 56573..57130 + 558 WP_001162012.1 recombinase family protein -
AM428_RS29055 57133..60097 + 2965 Protein_69 Tn3 family transposase -
AM428_RS29060 60176..61180 + 1005 WP_000427620.1 IS110-like element IS4321 family transposase -
AM428_RS29065 61362..61583 - 222 WP_000714163.1 hypothetical protein -
AM428_RS29070 61656..61934 - 279 WP_000268337.1 hypothetical protein -
AM428_RS29075 61921..63648 - 1728 WP_000122922.1 toprim domain-containing protein -
AM428_RS29080 63826..64212 - 387 WP_001077336.1 hypothetical protein -
AM428_RS29090 64671..65522 - 852 WP_000595210.1 hypothetical protein -
AM428_RS29095 65597..66154 - 558 WP_000064432.1 hypothetical protein -
AM428_RS29100 66228..66446 - 219 WP_000260293.1 hypothetical protein -
AM428_RS29105 66460..66729 - 270 WP_000184110.1 hypothetical protein -
AM428_RS29110 66722..67327 - 606 WP_000071870.1 5'-deoxynucleotidase -
AM428_RS29115 67399..67602 - 204 WP_000050847.1 hypothetical protein -
AM428_RS29120 67657..68091 - 435 WP_004200877.1 hypothetical protein -
AM428_RS29125 68356..68691 - 336 WP_001447572.1 hypothetical protein -
AM428_RS29130 68753..70549 - 1797 WP_000039319.1 VWA domain-containing protein -
AM428_RS29135 70634..71911 - 1278 WP_000170087.1 DUF3150 domain-containing protein -
AM428_RS29140 72111..73121 - 1011 WP_000706865.1 YqaJ viral recombinase family protein -
AM428_RS29145 73184..74173 - 990 WP_001282585.1 phage recombination protein Bet -
AM428_RS29150 74268..74798 - 531 WP_000987165.1 single-stranded DNA-binding protein -
AM428_RS29155 74859..75767 - 909 WP_000739139.1 hypothetical protein -
AM428_RS29160 75778..76746 - 969 WP_000085160.1 CbbQ/NirQ/NorQ C-terminal domain-containing protein -
AM428_RS29165 76966..77151 - 186 WP_001186917.1 hypothetical protein -
AM428_RS29170 77455..77775 - 321 WP_000547566.1 hypothetical protein -
AM428_RS29175 78070..78711 + 642 WP_000796664.1 hypothetical protein -
AM428_RS29180 78834..79694 + 861 WP_000709517.1 hypothetical protein -
AM428_RS29185 79733..82540 - 2808 WP_001447718.1 conjugal transfer mating pair stabilization protein TraN -
AM428_RS29190 82644..83651 - 1008 WP_000983282.1 TraU family protein -
AM428_RS29195 83648..84319 - 672 WP_000575345.1 EAL domain-containing protein -
AM428_RS29200 84316..85581 - 1266 WP_001447719.1 conjugal transfer protein TraW -
AM428_RS29205 85544..86074 - 531 WP_001010740.1 S26 family signal peptidase -
AM428_RS29210 86071..86388 - 318 WP_000351984.1 hypothetical protein -
AM428_RS29215 86403..88850 - 2448 WP_000637384.1 type IV secretion system protein TraC -
AM428_RS29220 88847..89554 - 708 WP_001259346.1 DsbC family protein -
AM428_RS29225 89703..95189 - 5487 WP_000606835.1 DUF4165 domain-containing protein -
AM428_RS29235 95917..96234 + 318 WP_000118520.1 quaternary ammonium compound efflux SMR transporter SugE -
AM428_RS29240 96231..96764 - 534 WP_001221666.1 lipocalin family protein -
AM428_RS29245 96858..98003 - 1146 WP_015058212.1 class C beta-lactamase CMY-6 -
AM428_RS29260 98327..99589 - 1263 WP_000608644.1 IS1380-like element ISEc9 family transposase -
AM428_RS29265 99874..100266 - 393 WP_000479535.1 hypothetical protein -
AM428_RS29270 100270..100848 - 579 WP_000793435.1 type IV conjugative transfer system lipoprotein TraV -
AM428_RS29275 100845..102158 - 1314 WP_024131605.1 conjugal transfer protein TraB -
AM428_RS29280 102158..103075 - 918 WP_000794249.1 type-F conjugative transfer system secretin TraK -
AM428_RS29285 103059..103685 - 627 WP_001049717.1 hypothetical protein -
AM428_RS29290 103682..103963 - 282 WP_000805625.1 type IV conjugative transfer system protein TraL -
AM428_RS29295 104108..104485 - 378 WP_001326174.1 hypothetical protein -
AM428_RS33485 104485..104628 - 144 WP_001275801.1 hypothetical protein -
AM428_RS29300 104809..105471 - 663 WP_001231464.1 hypothetical protein -
AM428_RS29305 105471..105848 - 378 WP_000869297.1 hypothetical protein -
AM428_RS29310 105858..106304 - 447 WP_000122507.1 hypothetical protein -
AM428_RS29315 106314..106943 - 630 WP_000743449.1 DUF4400 domain-containing protein -
AM428_RS29320 106900..107484 - 585 WP_000332868.1 hypothetical protein -
AM428_RS29325 107495..109360 - 1866 WP_000178857.1 conjugative transfer system coupling protein TraD -
AM428_RS29330 109357..112329 - 2973 WP_001326173.1 TraI domain-containing protein -
AM428_RS29335 112497..113114 + 618 WP_001249395.1 hypothetical protein -
AM428_RS29340 113096..113329 + 234 WP_001191890.1 hypothetical protein -
AM428_RS29345 113329..115521 + 2193 WP_000366823.1 DNA topoisomerase 3 -
AM428_RS29350 115536..116024 + 489 WP_004201072.1 hypothetical protein -
AM428_RS29355 116115..116414 - 300 WP_001326171.1 hypothetical protein -
AM428_RS29365 116626..117243 - 618 WP_000464630.1 hypothetical protein -
AM428_RS29370 117299..117955 - 657 WP_000268552.1 hypothetical protein -
AM428_RS29375 117955..119382 - 1428 WP_000936897.1 DNA cytosine methyltransferase -
AM428_RS29380 119386..119886 - 501 WP_000647188.1 hypothetical protein -
AM428_RS29385 119895..120206 - 312 WP_002210541.1 hypothetical protein -
AM428_RS29390 120212..120643 - 432 WP_001326170.1 hypothetical protein -
AM428_RS29395 120711..121385 - 675 WP_000344149.1 hypothetical protein -
AM428_RS33490 121360..121641 - 282 WP_000044823.1 hypothetical protein -
AM428_RS29405 121634..122011 - 378 WP_001125904.1 hypothetical protein -
AM428_RS33210 122338..122481 + 144 WP_000939033.1 hypothetical protein -
AM428_RS29415 122573..123208 + 636 WP_000074431.1 N-6 DNA methylase -
AM428_RS29420 123261..123533 - 273 WP_000703827.1 helix-turn-helix domain-containing protein -
AM428_RS29425 123582..124763 - 1182 WP_001207227.1 ParB/RepB/Spo0J family partition protein -
AM428_RS29430 124767..125552 - 786 WP_001151305.1 ParA family protein -
AM428_RS29440 125726..126037 - 312 WP_000380893.1 hypothetical protein -
AM428_RS29445 126019..126468 - 450 WP_001053910.1 hypothetical protein -
AM428_RS29450 126482..127726 - 1245 WP_000098294.1 site-specific DNA-methyltransferase -
AM428_RS29455 127719..128081 - 363 WP_001258026.1 hypothetical protein -
AM428_RS29460 128084..128326 - 243 WP_001096360.1 hypothetical protein -
AM428_RS29475 128761..129699 - 939 WP_000268394.1 chromosome partitioning protein ParB -
AM428_RS29480 129816..130361 - 546 WP_000435225.1 hypothetical protein -
AM428_RS29485 130364..130933 - 570 WP_001256126.1 hypothetical protein -
AM428_RS29490 130945..131508 - 564 WP_000004671.1 hypothetical protein -
AM428_RS29495 131501..131929 - 429 WP_000988988.1 hypothetical protein -
AM428_RS29500 131926..132273 - 348 WP_000039129.1 hypothetical protein -
AM428_RS33495 132285..133469 - 1185 WP_000245300.1 hypothetical protein -
AM428_RS33500 133463..133657 - 195 WP_000757530.1 DUF2997 domain-containing protein -
AM428_RS33505 133706..134098 - 393 WP_000018404.1 hypothetical protein -
AM428_RS29520 134160..135623 - 1464 WP_004201081.1 AAA family ATPase -
AM428_RS29525 135697..136629 - 933 WP_000434070.1 hypothetical protein -
AM428_RS29535 137191..137688 - 498 WP_000062185.1 hypothetical protein -
AM428_RS29540 137691..138179 - 489 WP_001273096.1 DUF1643 domain-containing protein -
AM428_RS29545 138276..138611 + 336 WP_000683477.1 hypothetical protein -
AM428_RS29550 138626..139096 - 471 WP_001281821.1 hypothetical protein -
AM428_RS29555 139089..139460 - 372 WP_000516918.1 hypothetical protein -
AM428_RS29560 139471..139665 - 195 WP_000343597.1 hypothetical protein -
AM428_RS29570 140006..140554 - 549 WP_001061573.1 hypothetical protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaNDM-1 / rmtC / sul1 / qacE / aac(6')-Ib / blaCMY-6 htpB 1..140825 140825


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

(33-79)


Sequences


Toxin        


Download         Length: -46824.666666667 a.a.        Molecular weight: 10855.68 Da        Isoelectric Point: 10.2267

>T70626 WP_000270043.1 NZ_CP018817:140717-242 [Klebsiella pneumoniae]

Download         Length: -140474 bp

>T70626 NZ_CP018817:140717-242 [Klebsiella pneumoniae]

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT70626 WP_000124640.1 NZ_CP018817:247-549 [Klebsiella pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp

>AT70626 NZ_CP018817:247-549 [Klebsiella pneumoniae]
ATGGCAAGAACTCTTGACCAAATGCTGGCAACAGAAAAGCCTGAGGTTGTTGCCAAAGCACAGAAAGCGGCCACTGAGAT
GTTACTGAACATCCACTTGGCAGAGCTTCGTGATCGCATGAACCTTACCCAGGGGGAAATTGCTGCATCTCTGGGTGTGA
GACAGCCGACAGTCTCCGAGATGGAAAAACCTGGACGAGATCTCAAGCTGTCGTCCATTAAGCGGTACGTTGAGGCCTCC
GGTGGCAAGCTACGCCTCGATGTTGAACTTCCGGACGGCACCCACTACGGCTTTGCCGTTTAA

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9


Antitoxin

Source ID Structure

References