Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 242..140717 | Replicon | plasmid unitig_1 |
| Accession | NZ_CP018817 | ||
| Organism | Klebsiella pneumoniae strain AR_0049 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | AM428_RS28655 | Protein ID | WP_000270043.1 |
| Coordinates | 140717..242 (+) | Length | -46824.666666667 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | AM428_RS28660 | Protein ID | WP_000124640.1 |
| Coordinates | 247..549 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM428_RS28660 | 247..549 | + | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| AM428_RS28665 | 576..869 | - | 294 | WP_001239998.1 | hypothetical protein | - |
| AM428_RS28670 | 958..1230 | - | 273 | WP_001043046.1 | HU family DNA-binding protein | - |
| AM428_RS28675 | 1288..1815 | - | 528 | WP_004201083.1 | thermonuclease family protein | - |
| AM428_RS33480 | 1818..2123 | - | 306 | WP_171820680.1 | hypothetical protein | - |
| AM428_RS28685 | 2035..2892 | - | 858 | WP_001167036.1 | hypothetical protein | - |
| AM428_RS28690 | 2879..3109 | - | 231 | WP_000972665.1 | hypothetical protein | - |
| AM428_RS28695 | 3109..3627 | - | 519 | WP_000210757.1 | nitrite reductase | - |
| AM428_RS28700 | 3624..4070 | - | 447 | WP_000919343.1 | hypothetical protein | - |
| AM428_RS28705 | 4070..4429 | - | 360 | WP_000422769.1 | hypothetical protein | - |
| AM428_RS28710 | 4487..4915 | - | 429 | WP_000591076.1 | hypothetical protein | - |
| AM428_RS28715 | 4949..5809 | - | 861 | WP_004201087.1 | DsbA family protein | - |
| AM428_RS28720 | 5825..6784 | - | 960 | WP_000829617.1 | S49 family peptidase | - |
| AM428_RS28725 | 6784..7638 | - | 855 | WP_000539391.1 | hypothetical protein | - |
| AM428_RS28730 | 7643..7936 | - | 294 | WP_001370730.1 | hypothetical protein | - |
| AM428_RS28735 | 7947..8420 | - | 474 | WP_000057876.1 | hypothetical protein | - |
| AM428_RS28740 | 8517..9038 | - | 522 | WP_000648873.1 | hypothetical protein | - |
| AM428_RS28745 | 9041..9562 | - | 522 | WP_000393783.1 | hypothetical protein | - |
| AM428_RS28750 | 9567..10175 | - | 609 | WP_000849069.1 | hypothetical protein | - |
| AM428_RS28760 | 10443..11558 | + | 1116 | WP_000946104.1 | phosphoadenosine phosphosulfate reductase family protein | - |
| AM428_RS28765 | 11576..12010 | + | 435 | WP_004201092.1 | hypothetical protein | - |
| AM428_RS28785 | 13047..14147 | - | 1101 | WP_001348532.1 | hypothetical protein | - |
| AM428_RS28790 | 14132..14419 | - | 288 | WP_000127321.1 | hypothetical protein | - |
| AM428_RS28795 | 14424..14963 | - | 540 | WP_001447712.1 | hypothetical protein | - |
| AM428_RS28800 | 15462..16445 | + | 984 | WP_000077457.1 | ParM/StbA family protein | - |
| AM428_RS28805 | 16462..16755 | + | 294 | WP_000919078.1 | hypothetical protein | - |
| AM428_RS28810 | 16757..17176 | + | 420 | WP_000651490.1 | H-NS histone family protein | - |
| AM428_RS28815 | 17236..17787 | - | 552 | WP_001020646.1 | hypothetical protein | - |
| AM428_RS28820 | 17784..18392 | - | 609 | WP_000891157.1 | hypothetical protein | - |
| AM428_RS28825 | 18403..18936 | - | 534 | WP_000790610.1 | transglycosylase SLT domain-containing protein | - |
| AM428_RS28830 | 18936..19208 | - | 273 | WP_000356489.1 | helix-turn-helix domain-containing protein | - |
| AM428_RS28835 | 19923..20285 | + | 363 | WP_000683483.1 | hypothetical protein | - |
| AM428_RS28840 | 20323..23937 | - | 3615 | WP_000534551.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| AM428_RS28845 | 23950..25383 | - | 1434 | WP_000256129.1 | conjugal transfer protein TraH | - |
| AM428_RS28850 | 25385..26425 | - | 1041 | WP_001326396.1 | conjugal transfer protein TraF | - |
| AM428_RS28855 | 26536..28047 | - | 1512 | WP_000811656.1 | ATP-dependent helicase | - |
| AM428_RS28865 | 28334..29374 | - | 1041 | WP_000101568.1 | DNA-binding protein | - |
| AM428_RS28870 | 29457..32474 | - | 3018 | WP_004199413.1 | Tn3-like element IS3000 family transposase | - |
| AM428_RS28875 | 32768..33643 | - | 876 | WP_001097010.1 | DNA replication terminus site-binding protein | - |
| AM428_RS28885 | 33960..34451 | - | 492 | WP_000139717.1 | hypothetical protein | - |
| AM428_RS28890 | 34448..35317 | - | 870 | WP_004201184.1 | 3'-5' exonuclease | - |
| AM428_RS28895 | 35322..36332 | - | 1011 | WP_000543934.1 | tyrosine-type recombinase/integrase | - |
| AM428_RS28900 | 36335..36871 | - | 537 | WP_000949433.1 | hypothetical protein | - |
| AM428_RS28910 | 37170..37451 | - | 282 | WP_000575657.1 | hypothetical protein | - |
| AM428_RS28915 | 37721..38323 | + | 603 | WP_000278322.1 | hypothetical protein | - |
| AM428_RS28920 | 38339..38791 | - | 453 | WP_000791469.1 | hypothetical protein | - |
| AM428_RS28925 | 38962..39402 | - | 441 | WP_001326394.1 | hypothetical protein | - |
| AM428_RS28930 | 39374..41872 | - | 2499 | Protein_48 | RHS repeat protein | - |
| AM428_RS28935 | 41844..42446 | - | 603 | Protein_49 | transposase zinc-binding domain-containing protein | - |
| AM428_RS28940 | 42635..44275 | - | 1641 | WP_004201176.1 | chaperonin GroEL | - |
| AM428_RS28945 | 44331..44621 | - | 291 | WP_004201172.1 | co-chaperone GroES | - |
| AM428_RS28950 | 44815..45144 | + | 330 | WP_004201171.1 | divalent-cation tolerance protein CutA | - |
| AM428_RS28955 | 45149..46180 | + | 1032 | WP_004201169.1 | protein-disulfide reductase DsbD N-terminal domain-containing protein | - |
| AM428_RS28960 | 46191..46829 | - | 639 | WP_004201168.1 | phosphoribosylanthranilate isomerase | - |
| AM428_RS28965 | 46834..47199 | - | 366 | WP_004201167.1 | bleomycin binding protein Ble-MBL | - |
| AM428_RS28970 | 47203..48015 | - | 813 | WP_004201164.1 | subclass B1 metallo-beta-lactamase NDM-1 | - |
| AM428_RS28975 | 48254..48951 | - | 698 | Protein_57 | IS1 family transposase | - |
| AM428_RS28990 | 49261..50106 | + | 846 | WP_000855769.1 | RmtC family 16S rRNA (guanine(1405)-N(7))-methyltransferase | - |
| AM428_RS28995 | 50204..50857 | - | 654 | WP_004201046.1 | endonuclease III | - |
| AM428_RS29000 | 51200..51751 | - | 552 | Protein_60 | DNA cytosine methyltransferase | - |
| AM428_RS29005 | 52084..52254 | + | 171 | WP_016479969.1 | hypothetical protein | - |
| AM428_RS29010 | 52368..52667 | + | 300 | WP_001183923.1 | DUF2293 domain-containing protein | - |
| AM428_RS29015 | 52751..52993 | - | 243 | WP_000376617.1 | hypothetical protein | - |
| AM428_RS29020 | 53120..53959 | - | 840 | WP_000259031.1 | sulfonamide-resistant dihydropteroate synthase Sul1 | - |
| AM428_RS29025 | 53953..54300 | - | 348 | WP_000679427.1 | quaternary ammonium compound efflux SMR transporter QacE delta 1 | - |
| AM428_RS29030 | 54469..55023 | - | 555 | WP_032488579.1 | aminoglycoside N-acetyltransferase AAC(6')-Ib3 | - |
| AM428_RS29040 | 55254..56267 | + | 1014 | WP_000845039.1 | class 1 integron integrase IntI1 | - |
| AM428_RS29050 | 56573..57130 | + | 558 | WP_001162012.1 | recombinase family protein | - |
| AM428_RS29055 | 57133..60097 | + | 2965 | Protein_69 | Tn3 family transposase | - |
| AM428_RS29060 | 60176..61180 | + | 1005 | WP_000427620.1 | IS110-like element IS4321 family transposase | - |
| AM428_RS29065 | 61362..61583 | - | 222 | WP_000714163.1 | hypothetical protein | - |
| AM428_RS29070 | 61656..61934 | - | 279 | WP_000268337.1 | hypothetical protein | - |
| AM428_RS29075 | 61921..63648 | - | 1728 | WP_000122922.1 | toprim domain-containing protein | - |
| AM428_RS29080 | 63826..64212 | - | 387 | WP_001077336.1 | hypothetical protein | - |
| AM428_RS29090 | 64671..65522 | - | 852 | WP_000595210.1 | hypothetical protein | - |
| AM428_RS29095 | 65597..66154 | - | 558 | WP_000064432.1 | hypothetical protein | - |
| AM428_RS29100 | 66228..66446 | - | 219 | WP_000260293.1 | hypothetical protein | - |
| AM428_RS29105 | 66460..66729 | - | 270 | WP_000184110.1 | hypothetical protein | - |
| AM428_RS29110 | 66722..67327 | - | 606 | WP_000071870.1 | 5'-deoxynucleotidase | - |
| AM428_RS29115 | 67399..67602 | - | 204 | WP_000050847.1 | hypothetical protein | - |
| AM428_RS29120 | 67657..68091 | - | 435 | WP_004200877.1 | hypothetical protein | - |
| AM428_RS29125 | 68356..68691 | - | 336 | WP_001447572.1 | hypothetical protein | - |
| AM428_RS29130 | 68753..70549 | - | 1797 | WP_000039319.1 | VWA domain-containing protein | - |
| AM428_RS29135 | 70634..71911 | - | 1278 | WP_000170087.1 | DUF3150 domain-containing protein | - |
| AM428_RS29140 | 72111..73121 | - | 1011 | WP_000706865.1 | YqaJ viral recombinase family protein | - |
| AM428_RS29145 | 73184..74173 | - | 990 | WP_001282585.1 | phage recombination protein Bet | - |
| AM428_RS29150 | 74268..74798 | - | 531 | WP_000987165.1 | single-stranded DNA-binding protein | - |
| AM428_RS29155 | 74859..75767 | - | 909 | WP_000739139.1 | hypothetical protein | - |
| AM428_RS29160 | 75778..76746 | - | 969 | WP_000085160.1 | CbbQ/NirQ/NorQ C-terminal domain-containing protein | - |
| AM428_RS29165 | 76966..77151 | - | 186 | WP_001186917.1 | hypothetical protein | - |
| AM428_RS29170 | 77455..77775 | - | 321 | WP_000547566.1 | hypothetical protein | - |
| AM428_RS29175 | 78070..78711 | + | 642 | WP_000796664.1 | hypothetical protein | - |
| AM428_RS29180 | 78834..79694 | + | 861 | WP_000709517.1 | hypothetical protein | - |
| AM428_RS29185 | 79733..82540 | - | 2808 | WP_001447718.1 | conjugal transfer mating pair stabilization protein TraN | - |
| AM428_RS29190 | 82644..83651 | - | 1008 | WP_000983282.1 | TraU family protein | - |
| AM428_RS29195 | 83648..84319 | - | 672 | WP_000575345.1 | EAL domain-containing protein | - |
| AM428_RS29200 | 84316..85581 | - | 1266 | WP_001447719.1 | conjugal transfer protein TraW | - |
| AM428_RS29205 | 85544..86074 | - | 531 | WP_001010740.1 | S26 family signal peptidase | - |
| AM428_RS29210 | 86071..86388 | - | 318 | WP_000351984.1 | hypothetical protein | - |
| AM428_RS29215 | 86403..88850 | - | 2448 | WP_000637384.1 | type IV secretion system protein TraC | - |
| AM428_RS29220 | 88847..89554 | - | 708 | WP_001259346.1 | DsbC family protein | - |
| AM428_RS29225 | 89703..95189 | - | 5487 | WP_000606835.1 | DUF4165 domain-containing protein | - |
| AM428_RS29235 | 95917..96234 | + | 318 | WP_000118520.1 | quaternary ammonium compound efflux SMR transporter SugE | - |
| AM428_RS29240 | 96231..96764 | - | 534 | WP_001221666.1 | lipocalin family protein | - |
| AM428_RS29245 | 96858..98003 | - | 1146 | WP_015058212.1 | class C beta-lactamase CMY-6 | - |
| AM428_RS29260 | 98327..99589 | - | 1263 | WP_000608644.1 | IS1380-like element ISEc9 family transposase | - |
| AM428_RS29265 | 99874..100266 | - | 393 | WP_000479535.1 | hypothetical protein | - |
| AM428_RS29270 | 100270..100848 | - | 579 | WP_000793435.1 | type IV conjugative transfer system lipoprotein TraV | - |
| AM428_RS29275 | 100845..102158 | - | 1314 | WP_024131605.1 | conjugal transfer protein TraB | - |
| AM428_RS29280 | 102158..103075 | - | 918 | WP_000794249.1 | type-F conjugative transfer system secretin TraK | - |
| AM428_RS29285 | 103059..103685 | - | 627 | WP_001049717.1 | hypothetical protein | - |
| AM428_RS29290 | 103682..103963 | - | 282 | WP_000805625.1 | type IV conjugative transfer system protein TraL | - |
| AM428_RS29295 | 104108..104485 | - | 378 | WP_001326174.1 | hypothetical protein | - |
| AM428_RS33485 | 104485..104628 | - | 144 | WP_001275801.1 | hypothetical protein | - |
| AM428_RS29300 | 104809..105471 | - | 663 | WP_001231464.1 | hypothetical protein | - |
| AM428_RS29305 | 105471..105848 | - | 378 | WP_000869297.1 | hypothetical protein | - |
| AM428_RS29310 | 105858..106304 | - | 447 | WP_000122507.1 | hypothetical protein | - |
| AM428_RS29315 | 106314..106943 | - | 630 | WP_000743449.1 | DUF4400 domain-containing protein | - |
| AM428_RS29320 | 106900..107484 | - | 585 | WP_000332868.1 | hypothetical protein | - |
| AM428_RS29325 | 107495..109360 | - | 1866 | WP_000178857.1 | conjugative transfer system coupling protein TraD | - |
| AM428_RS29330 | 109357..112329 | - | 2973 | WP_001326173.1 | TraI domain-containing protein | - |
| AM428_RS29335 | 112497..113114 | + | 618 | WP_001249395.1 | hypothetical protein | - |
| AM428_RS29340 | 113096..113329 | + | 234 | WP_001191890.1 | hypothetical protein | - |
| AM428_RS29345 | 113329..115521 | + | 2193 | WP_000366823.1 | DNA topoisomerase 3 | - |
| AM428_RS29350 | 115536..116024 | + | 489 | WP_004201072.1 | hypothetical protein | - |
| AM428_RS29355 | 116115..116414 | - | 300 | WP_001326171.1 | hypothetical protein | - |
| AM428_RS29365 | 116626..117243 | - | 618 | WP_000464630.1 | hypothetical protein | - |
| AM428_RS29370 | 117299..117955 | - | 657 | WP_000268552.1 | hypothetical protein | - |
| AM428_RS29375 | 117955..119382 | - | 1428 | WP_000936897.1 | DNA cytosine methyltransferase | - |
| AM428_RS29380 | 119386..119886 | - | 501 | WP_000647188.1 | hypothetical protein | - |
| AM428_RS29385 | 119895..120206 | - | 312 | WP_002210541.1 | hypothetical protein | - |
| AM428_RS29390 | 120212..120643 | - | 432 | WP_001326170.1 | hypothetical protein | - |
| AM428_RS29395 | 120711..121385 | - | 675 | WP_000344149.1 | hypothetical protein | - |
| AM428_RS33490 | 121360..121641 | - | 282 | WP_000044823.1 | hypothetical protein | - |
| AM428_RS29405 | 121634..122011 | - | 378 | WP_001125904.1 | hypothetical protein | - |
| AM428_RS33210 | 122338..122481 | + | 144 | WP_000939033.1 | hypothetical protein | - |
| AM428_RS29415 | 122573..123208 | + | 636 | WP_000074431.1 | N-6 DNA methylase | - |
| AM428_RS29420 | 123261..123533 | - | 273 | WP_000703827.1 | helix-turn-helix domain-containing protein | - |
| AM428_RS29425 | 123582..124763 | - | 1182 | WP_001207227.1 | ParB/RepB/Spo0J family partition protein | - |
| AM428_RS29430 | 124767..125552 | - | 786 | WP_001151305.1 | ParA family protein | - |
| AM428_RS29440 | 125726..126037 | - | 312 | WP_000380893.1 | hypothetical protein | - |
| AM428_RS29445 | 126019..126468 | - | 450 | WP_001053910.1 | hypothetical protein | - |
| AM428_RS29450 | 126482..127726 | - | 1245 | WP_000098294.1 | site-specific DNA-methyltransferase | - |
| AM428_RS29455 | 127719..128081 | - | 363 | WP_001258026.1 | hypothetical protein | - |
| AM428_RS29460 | 128084..128326 | - | 243 | WP_001096360.1 | hypothetical protein | - |
| AM428_RS29475 | 128761..129699 | - | 939 | WP_000268394.1 | chromosome partitioning protein ParB | - |
| AM428_RS29480 | 129816..130361 | - | 546 | WP_000435225.1 | hypothetical protein | - |
| AM428_RS29485 | 130364..130933 | - | 570 | WP_001256126.1 | hypothetical protein | - |
| AM428_RS29490 | 130945..131508 | - | 564 | WP_000004671.1 | hypothetical protein | - |
| AM428_RS29495 | 131501..131929 | - | 429 | WP_000988988.1 | hypothetical protein | - |
| AM428_RS29500 | 131926..132273 | - | 348 | WP_000039129.1 | hypothetical protein | - |
| AM428_RS33495 | 132285..133469 | - | 1185 | WP_000245300.1 | hypothetical protein | - |
| AM428_RS33500 | 133463..133657 | - | 195 | WP_000757530.1 | DUF2997 domain-containing protein | - |
| AM428_RS33505 | 133706..134098 | - | 393 | WP_000018404.1 | hypothetical protein | - |
| AM428_RS29520 | 134160..135623 | - | 1464 | WP_004201081.1 | AAA family ATPase | - |
| AM428_RS29525 | 135697..136629 | - | 933 | WP_000434070.1 | hypothetical protein | - |
| AM428_RS29535 | 137191..137688 | - | 498 | WP_000062185.1 | hypothetical protein | - |
| AM428_RS29540 | 137691..138179 | - | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| AM428_RS29545 | 138276..138611 | + | 336 | WP_000683477.1 | hypothetical protein | - |
| AM428_RS29550 | 138626..139096 | - | 471 | WP_001281821.1 | hypothetical protein | - |
| AM428_RS29555 | 139089..139460 | - | 372 | WP_000516918.1 | hypothetical protein | - |
| AM428_RS29560 | 139471..139665 | - | 195 | WP_000343597.1 | hypothetical protein | - |
| AM428_RS29570 | 140006..140554 | - | 549 | WP_001061573.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaNDM-1 / rmtC / sul1 / qacE / aac(6')-Ib / blaCMY-6 | htpB | 1..140825 | 140825 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: -46824.666666667 a.a. Molecular weight: 10855.68 Da Isoelectric Point: 10.2267
>T70626 WP_000270043.1 NZ_CP018817:140717-242 [Klebsiella pneumoniae]
Download Length: -140474 bp
>T70626 NZ_CP018817:140717-242 [Klebsiella pneumoniae]
Antitoxin
Download Length: 101 a.a. Molecular weight: 11006.73 Da Isoelectric Point: 7.2036
>AT70626 WP_000124640.1 NZ_CP018817:247-549 [Klebsiella pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
Download Length: 303 bp
>AT70626 NZ_CP018817:247-549 [Klebsiella pneumoniae]
ATGGCAAGAACTCTTGACCAAATGCTGGCAACAGAAAAGCCTGAGGTTGTTGCCAAAGCACAGAAAGCGGCCACTGAGAT
GTTACTGAACATCCACTTGGCAGAGCTTCGTGATCGCATGAACCTTACCCAGGGGGAAATTGCTGCATCTCTGGGTGTGA
GACAGCCGACAGTCTCCGAGATGGAAAAACCTGGACGAGATCTCAAGCTGTCGTCCATTAAGCGGTACGTTGAGGCCTCC
GGTGGCAAGCTACGCCTCGATGTTGAACTTCCGGACGGCACCCACTACGGCTTTGCCGTTTAA
ATGGCAAGAACTCTTGACCAAATGCTGGCAACAGAAAAGCCTGAGGTTGTTGCCAAAGCACAGAAAGCGGCCACTGAGAT
GTTACTGAACATCCACTTGGCAGAGCTTCGTGATCGCATGAACCTTACCCAGGGGGAAATTGCTGCATCTCTGGGTGTGA
GACAGCCGACAGTCTCCGAGATGGAAAAACCTGGACGAGATCTCAAGCTGTCGTCCATTAAGCGGTACGTTGAGGCCTCC
GGTGGCAAGCTACGCCTCGATGTTGAACTTCCGGACGGCACCCACTACGGCTTTGCCGTTTAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|