Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2062533..2062832 | Replicon | chromosome |
Accession | NZ_CP018768 | ||
Organism | Staphylococcus aureus strain UCI 28 isolate ST5 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | BSG37_RS10605 | Protein ID | WP_011447039.1 |
Coordinates | 2062656..2062832 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2062533..2062588 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BSG37_RS10550 | 2057939..2058124 | + | 186 | WP_031784682.1 | hypothetical protein | - |
BSG37_RS10555 | 2058177..2058527 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
BSG37_RS10560 | 2059212..2059661 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
BSG37_RS15140 | 2059756..2060091 | - | 336 | Protein_1953 | SH3 domain-containing protein | - |
BSG37_RS10585 | 2060741..2061232 | - | 492 | WP_000919350.1 | staphylokinase | - |
BSG37_RS10590 | 2061423..2062178 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
BSG37_RS10595 | 2062190..2062444 | - | 255 | WP_000611512.1 | phage holin | - |
BSG37_RS10600 | 2062496..2062603 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2062525..2062664 | + | 140 | NuclAT_0 | - | - |
- | 2062525..2062664 | + | 140 | NuclAT_0 | - | - |
- | 2062525..2062664 | + | 140 | NuclAT_0 | - | - |
- | 2062525..2062664 | + | 140 | NuclAT_0 | - | - |
- | 2062533..2062588 | + | 56 | - | - | Antitoxin |
BSG37_RS10605 | 2062656..2062832 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
BSG37_RS10610 | 2062982..2063278 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
BSG37_RS10615 | 2063336..2063623 | - | 288 | WP_001040261.1 | hypothetical protein | - |
BSG37_RS10620 | 2063670..2063822 | - | 153 | WP_001153681.1 | hypothetical protein | - |
BSG37_RS10625 | 2063812..2067597 | - | 3786 | WP_000582154.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2058177..2108671 | 50494 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T70434 WP_011447039.1 NZ_CP018768:c2062832-2062656 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T70434 NZ_CP018768:c2062832-2062656 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT70434 NZ_CP018768:2062533-2062588 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|