Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 541140..541322 | Replicon | chromosome |
Accession | NZ_CP018629 | ||
Organism | Staphylococcus aureus strain MRSA107 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | BTN44_RS16505 | Protein ID | WP_001801861.1 |
Coordinates | 541227..541322 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 541140..541199 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BTN44_RS03015 | 537266..538437 | + | 1172 | Protein_534 | IS256-like element IS256 family transposase | - |
BTN44_RS03025 | 538489..539757 | + | 1269 | Protein_535 | ATP-binding protein | - |
BTN44_RS03030 | 540278..540655 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
BTN44_RS03035 | 540849..541025 | + | 177 | Protein_537 | transposase | - |
BTN44_RS03040 | 541003..541104 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 541140..541199 | + | 60 | - | - | Antitoxin |
BTN44_RS16505 | 541227..541322 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
BTN44_RS03050 | 541525..541668 | + | 144 | WP_001549059.1 | transposase | - |
BTN44_RS03060 | 542272..542655 | + | 384 | WP_000070811.1 | hypothetical protein | - |
BTN44_RS03065 | 542666..542842 | + | 177 | WP_000375476.1 | hypothetical protein | - |
BTN44_RS03070 | 542844..543029 | + | 186 | WP_000809857.1 | hypothetical protein | - |
BTN44_RS03075 | 543143..543784 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
BTN44_RS03080 | 544002..544553 | - | 552 | WP_000414205.1 | hypothetical protein | - |
BTN44_RS03085 | 544651..544995 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
BTN44_RS03090 | 545036..545662 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hlgA / lukD | 506639..567347 | 60708 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T70113 WP_001801861.1 NZ_CP018629:c541322-541227 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T70113 NZ_CP018629:c541322-541227 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT70113 NZ_CP018629:541140-541199 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|