Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 79252..79516 | Replicon | plasmid pFORC44_1 |
Accession | NZ_CP018625 | ||
Organism | Escherichia coli strain FORC_044 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | FORC44_RS29930 | Protein ID | WP_001331364.1 |
Coordinates | 79364..79516 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 79252..79309 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC44_RS29915 | 74491..76782 | - | 2292 | WP_001289276.1 | hypothetical protein | - |
FORC44_RS29920 | 76775..77845 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
FORC44_RS29925 | 77864..79072 | - | 1209 | WP_000121274.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 79252..79309 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 79252..79309 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 79252..79309 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 79252..79309 | - | 58 | NuclAT_0 | - | Antitoxin |
FORC44_RS29930 | 79364..79516 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
FORC44_RS31695 | 79588..79728 | - | 141 | WP_000880644.1 | hypothetical protein | - |
FORC44_RS29935 | 80139..80435 | + | 297 | WP_001275298.1 | hypothetical protein | - |
FORC44_RS31700 | 80500..80676 | - | 177 | WP_001054904.1 | hypothetical protein | - |
FORC44_RS29940 | 81068..81277 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
FORC44_RS29945 | 81349..82011 | - | 663 | WP_000653334.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
FORC44_RS29950 | 82076..84238 | - | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B | - | 1..111755 | 111755 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T70103 WP_001331364.1 NZ_CP018625:79364-79516 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T70103 NZ_CP018625:79364-79516 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT70103 NZ_CP018625:c79309-79252 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|