Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 99820..100073 | Replicon | plasmid unnamed |
Accession | NZ_CP018455 | ||
Organism | Klebsiella pneumoniae strain SWU01 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | BSL40_RS29945 | Protein ID | WP_001312851.1 |
Coordinates | 99924..100073 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 99820..99879 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BSL40_RS29905 | 95480..95545 | - | 66 | Protein_123 | helix-turn-helix domain-containing protein | - |
BSL40_RS29915 | 95598..96302 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
BSL40_RS30835 | 96366..96527 | + | 162 | Protein_125 | DNA helicase | - |
BSL40_RS29920 | 96547..97293 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
BSL40_RS29925 | 97348..97908 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
BSL40_RS29930 | 98040..98240 | + | 201 | WP_015059022.1 | hypothetical protein | - |
BSL40_RS29935 | 98626..99225 | + | 600 | WP_032083981.1 | hypothetical protein | - |
BSL40_RS29940 | 99389..99619 | + | 231 | WP_001736714.1 | hypothetical protein | - |
- | 99820..99879 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 99820..99879 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 99820..99879 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 99820..99879 | - | 60 | NuclAT_1 | - | Antitoxin |
BSL40_RS29945 | 99924..100073 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BSL40_RS29950 | 100357..100605 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
BSL40_RS29960 | 100850..100924 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
BSL40_RS29965 | 100917..101774 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
BSL40_RS32060 | 102713..102877 | + | 165 | WP_187417362.1 | hypothetical protein | - |
BSL40_RS29985 | 102914..103618 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-65 / blaSHV-12 / blaKPC-2 / rmtB / blaTEM-1B | - | 1..162552 | 162552 | |
- | flank | IS/Tn | - | - | 102914..103618 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T70065 WP_001312851.1 NZ_CP018455:99924-100073 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T70065 NZ_CP018455:99924-100073 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT70065 NZ_CP018455:c99879-99820 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|