Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 19897..20167 | Replicon | plasmid pKp_Goe_414-6 |
| Accession | NZ_CP018343 | ||
| Organism | Klebsiella pneumoniae isolate Kp_Goe_154414 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BB788_RS30815 | Protein ID | WP_001312861.1 |
| Coordinates | 20009..20167 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 19897..19960 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BB788_RS30790 | 15608..16135 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| BB788_RS30795 | 16193..16426 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| BB788_RS30800 | 16487..18510 | + | 2024 | Protein_22 | ParB/RepB/Spo0J family partition protein | - |
| BB788_RS30805 | 18579..19013 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| BB788_RS30810 | 19010..19729 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 19741..19965 | + | 225 | NuclAT_0 | - | - |
| - | 19741..19965 | + | 225 | NuclAT_0 | - | - |
| - | 19741..19965 | + | 225 | NuclAT_0 | - | - |
| - | 19741..19965 | + | 225 | NuclAT_0 | - | - |
| - | 19897..19960 | - | 64 | - | - | Antitoxin |
| BB788_RS30815 | 20009..20167 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| BB788_RS30820 | 20525..20950 | + | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
| BB788_RS30825 | 20947..21297 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| BB788_RS30830 | 21328..22941 | + | 1614 | WP_000080200.1 | IS66-like element ISEc23 family transposase | - |
| BB788_RS32750 | 23026..23230 | - | 205 | Protein_29 | pilus protein | - |
| BB788_RS30850 | 23622..23918 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| BB788_RS30855 | 24029..24850 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-55 / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa | - | 1..57266 | 57266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T69773 WP_001312861.1 NZ_CP018343:20009-20167 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T69773 NZ_CP018343:20009-20167 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT69773 NZ_CP018343:c19960-19897 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|